Clone MIP29231 Report

Search the DGRC for MIP29231

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:292
Well:31
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42869-RB
Protein status:MIP29231.pep: gold
Sequenced Size:308

Clone Sequence Records

MIP29231.complete Sequence

308 bp assembled on 2011-03-18

GenBank Submission: BT126143.1

> MIP29231.complete
AACTTTAAACTTTTCCAGCACGAAGATGTTGATAGCCCGACTGGCGTTTT
TAGTCTCTATTCTGGGCATTGTGGTTGGGTTCCAGAAACTGGACTCCACT
TCCAGTCCCACGACTACCAGCACTATGAGGTCTGCCCCTTATTGTCAGCC
AAGTGGAGGATATTGTCGGATGCATATGGATTGCTGTTCGCGAATGTGCA
TTCAAGTGTCAGCAGAGTGTCGCTAGAATAAATTGAATACCTTATGCTTG
GAGTTTGATATATTAAAACGATTTAATAGAGTGAAAAAAAAAAAAAAAAA
AAAAAAAA

MIP29231.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17560449..17560611 163..1 815 100 Minus
chr3R 27901430 chr3R 17560275..17560398 283..160 605 99.2 Minus
chr3R 27901430 chr3R 3875405..3875516 160..283 330 86.3 Plus
chr3R 27901430 chr3R 3875279..3875353 89..163 300 93.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21736687..21736849 163..1 815 100 Minus
3R 32079331 3R 21736513..21736636 283..160 605 99.2 Minus
3R 32079331 3R 8049209..8049283 89..163 315 94.7 Plus
3R 32079331 3R 8049345..8049456 160..283 315 85.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21477518..21477680 163..1 815 100 Minus
3R 31820162 3R 21477344..21477467 283..160 605 99.1 Minus
3R 31820162 3R 7790040..7790114 89..163 315 94.6 Plus
3R 31820162 3R 7790176..7790249 160..233 310 94.5 Plus
3R 31820162 3R 7790248..7790287 244..283 170 95 Plus
Blast to na_te.dros performed on 2019-03-16 22:31:12 has no hits.

MIP29231.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:32:08 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17560275..17560394 164..283 100 <- Minus
chr3R 17560449..17560611 1..163 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-18 09:53:56 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
CG42869-RA 1..102 125..226 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:56:38 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
CG42869-RB 1..201 26..226 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:28:53 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
CG42869-RB 1..201 26..226 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-18 09:53:55 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
CG42869-RA 1..249 35..283 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:56:38 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
CG42869-RB 1..283 1..283 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:28:53 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
CG42869-RB 1..283 1..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:08 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21736513..21736632 164..283 100 <- Minus
3R 21736687..21736849 1..163 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:08 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21736513..21736632 164..283 100 <- Minus
3R 21736687..21736849 1..163 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:08 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21736513..21736632 164..283 100 <- Minus
3R 21736687..21736849 1..163 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:56:38 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17562409..17562571 1..163 100   Minus
arm_3R 17562235..17562354 164..283 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:30 Download gff for MIP29231.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21477344..21477463 164..283 100 <- Minus
3R 21477518..21477680 1..163 100   Minus

MIP29231.hyp Sequence

Translation from 0 to 230

> MIP29231.hyp
NFKLFQHEDVDSPTGVFSLYSGHCGWVPETGLHFQSHDYQHYEVCPLLSA
KWRILSDAYGLLFANVHSSVSRVSLE*
Sequence MIP29231.hyp has no blast hits.

MIP29231.pep Sequence

Translation from 1 to 225

> MIP29231.pep
TLNFSSTKMLIARLAFLVSILGIVVGFQKLDSTSSPTTTSTMRSAPYCQP
SGGYCRMHMDCCSRMCIQVSAECR*

MIP29231.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42869-PB 66 CG42869-PB 1..66 9..74 349 100 Plus
CG43618-PA 56 CG43618-PA 2..56 17..74 253 81 Plus