Clone MIP29232 Report

Search the DGRC for MIP29232

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:292
Well:32
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43111-RA
Protein status:MIP29232.pep: gold
Sequenced Size:549

Clone Sequence Records

MIP29232.complete Sequence

549 bp assembled on 2011-03-01

GenBank Submission: BT126113.1

> MIP29232.complete
TAGAATATACTTTCAAAGAATGAATCATCTGTTCGTGTTAACTTTTATTC
TGCTTTTTGCCTTTGCCTTGGGATCCGAAGGTGAATTGACCGAAATGTGC
CAACCACAATTAAACAGAAGAGACCTATTCGACATAGCCGTGTTGGCCGC
CATAAAGGTTCTCATCCGTCAGATTGAGAGCTACAACGAGGATCGGCCTA
TCTCTTCAAGCCTGATGGTTCACATTACGACTATGGTCTCCAAGTACATC
CTGACCGGTAAGAGCGTAAAGTTCATCCTTCGGCTGCTCTATGTGGCATG
CCGTATGAACAAACCGCTGACACAAGAAAATAAAAAACAAGCTCCAGTCC
GCACAGCATTCTTATGCTTGTTGGAATTGGGCAAAGAAAAGTGCTATACA
TACAAGGAAAAGGCGGAAGGAGACTTCTCTGTGGAGTTGCAATGAATTGA
ATTGAATTTATCCGTGATTCTTTCAAAATTACTTGATGCAATTCGAATTA
TAAATAAATTTATATTGGTTATAGATTTTCGGTAAAAAAAAAAAAAAAA

MIP29232.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15439405..15439916 22..533 2500 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19552162..19552675 22..535 2570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19553361..19553874 22..535 2570 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:15:04 has no hits.

MIP29232.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:15:58 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15439335..15439356 1..22 95 -> Plus
chr2R 15439406..15439916 23..533 95   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 13:20:42 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
CG43111-RA 1..426 20..445 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:46 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
CG43111-RA 1..426 20..445 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:18 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
CG43111-RA 1..426 20..445 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 13:20:41 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
CG43111-RA 22..554 1..533 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:46 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
CG43111-RA 22..553 1..532 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:18 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
CG43111-RA 22..553 1..532 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:58 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19552092..19552113 1..22 95 -> Plus
2R 19552163..19552673 23..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:58 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19552092..19552113 1..22 95 -> Plus
2R 19552163..19552673 23..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:58 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19552092..19552113 1..22 95 -> Plus
2R 19552163..19552673 23..533 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:46 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15439597..15439618 1..22 95 -> Plus
arm_2R 15439668..15440178 23..533 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:16 Download gff for MIP29232.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19553362..19553872 23..533 100   Plus
2R 19553291..19553312 1..22 95 -> Plus

MIP29232.hyp Sequence

Translation from 0 to 444

> MIP29232.hyp
RINFQRMNHLFVLTFILLFAFALGSEGELTEMCQPQLNRRDLFDIAVLAA
IKVLIRQIESYNEDRPISSSLMVHITTMVSKYILTGKSVKFILRLLYVAC
RMNKPLTQENKKQAPVRTAFLCLLELGKEKCYTYKEKAEGDFSVELQ*

MIP29232.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG43111-PA 141 CG43111-PA 1..141 7..147 711 100 Plus

MIP29232.pep Sequence

Translation from 1 to 444

> MIP29232.pep
RIYFQRMNHLFVLTFILLFAFALGSEGELTEMCQPQLNRRDLFDIAVLAA
IKVLIRQIESYNEDRPISSSLMVHITTMVSKYILTGKSVKFILRLLYVAC
RMNKPLTQENKKQAPVRTAFLCLLELGKEKCYTYKEKAEGDFSVELQ*

MIP29232.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11724-PA 198 GF11724-PA 1..138 7..141 255 38.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21986-PA 141 GG21986-PA 1..141 7..147 587 75.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG43111-PA 141 CG43111-PA 1..141 7..147 711 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10349-PA 408 GL10349-PA 102..176 31..105 146 30.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24939-PA 379 GA24939-PA 60..134 31..105 146 30.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12064-PA 116 GE12064-PA 1..115 32..146 501 78.3 Plus