Clone Sequence Records
MIP29232.complete Sequence
549 bp assembled on 2011-03-01
GenBank Submission: BT126113.1
> MIP29232.complete
TAGAATATACTTTCAAAGAATGAATCATCTGTTCGTGTTAACTTTTATTC
TGCTTTTTGCCTTTGCCTTGGGATCCGAAGGTGAATTGACCGAAATGTGC
CAACCACAATTAAACAGAAGAGACCTATTCGACATAGCCGTGTTGGCCGC
CATAAAGGTTCTCATCCGTCAGATTGAGAGCTACAACGAGGATCGGCCTA
TCTCTTCAAGCCTGATGGTTCACATTACGACTATGGTCTCCAAGTACATC
CTGACCGGTAAGAGCGTAAAGTTCATCCTTCGGCTGCTCTATGTGGCATG
CCGTATGAACAAACCGCTGACACAAGAAAATAAAAAACAAGCTCCAGTCC
GCACAGCATTCTTATGCTTGTTGGAATTGGGCAAAGAAAAGTGCTATACA
TACAAGGAAAAGGCGGAAGGAGACTTCTCTGTGGAGTTGCAATGAATTGA
ATTGAATTTATCCGTGATTCTTTCAAAATTACTTGATGCAATTCGAATTA
TAAATAAATTTATATTGGTTATAGATTTTCGGTAAAAAAAAAAAAAAAA
MIP29232.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 15439405..15439916 | 22..533 | 2500 | 99.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 19552162..19552675 | 22..535 | 2570 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 19553361..19553874 | 22..535 | 2570 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 22:15:04 has no hits.
MIP29232.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:15:58 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 15439335..15439356 | 1..22 | 95 | -> | Plus |
chr2R | 15439406..15439916 | 23..533 | 95 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 13:20:42 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43111-RA | 1..426 | 20..445 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:46 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43111-RA | 1..426 | 20..445 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:18 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43111-RA | 1..426 | 20..445 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 13:20:41 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43111-RA | 22..554 | 1..533 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:46 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43111-RA | 22..553 | 1..532 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:18 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43111-RA | 22..553 | 1..532 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:58 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19552092..19552113 | 1..22 | 95 | -> | Plus |
2R | 19552163..19552673 | 23..533 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:58 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19552092..19552113 | 1..22 | 95 | -> | Plus |
2R | 19552163..19552673 | 23..533 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:58 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19552092..19552113 | 1..22 | 95 | -> | Plus |
2R | 19552163..19552673 | 23..533 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:46 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 15439597..15439618 | 1..22 | 95 | -> | Plus |
arm_2R | 15439668..15440178 | 23..533 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:16 Download gff for
MIP29232.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19553362..19553872 | 23..533 | 100 | | Plus |
2R | 19553291..19553312 | 1..22 | 95 | -> | Plus |
MIP29232.hyp Sequence
Translation from 0 to 444
> MIP29232.hyp
RINFQRMNHLFVLTFILLFAFALGSEGELTEMCQPQLNRRDLFDIAVLAA
IKVLIRQIESYNEDRPISSSLMVHITTMVSKYILTGKSVKFILRLLYVAC
RMNKPLTQENKKQAPVRTAFLCLLELGKEKCYTYKEKAEGDFSVELQ*
MIP29232.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43111-PA | 141 | CG43111-PA | 1..141 | 7..147 | 711 | 100 | Plus |
MIP29232.pep Sequence
Translation from 1 to 444
> MIP29232.pep
RIYFQRMNHLFVLTFILLFAFALGSEGELTEMCQPQLNRRDLFDIAVLAA
IKVLIRQIESYNEDRPISSSLMVHITTMVSKYILTGKSVKFILRLLYVAC
RMNKPLTQENKKQAPVRTAFLCLLELGKEKCYTYKEKAEGDFSVELQ*
MIP29232.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:57:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF11724-PA | 198 | GF11724-PA | 1..138 | 7..141 | 255 | 38.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:57:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21986-PA | 141 | GG21986-PA | 1..141 | 7..147 | 587 | 75.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43111-PA | 141 | CG43111-PA | 1..141 | 7..147 | 711 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:57:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10349-PA | 408 | GL10349-PA | 102..176 | 31..105 | 146 | 30.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:57:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA24939-PA | 379 | GA24939-PA | 60..134 | 31..105 | 146 | 30.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:57:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12064-PA | 116 | GE12064-PA | 1..115 | 32..146 | 501 | 78.3 | Plus |