MIP29362.complete Sequence
407 bp assembled on 2011-03-01
GenBank Submission: BT126116.1
> MIP29362.complete
TTTTTTCCCGCCTATGTTCTATATTTAAATCGTTTGAATAGGTTACCCAA
CCACAACACATAAGTGAAGAAAGACAAAATCTTCTAAATTAGTTAAGCAA
TCTATTCAAGATGTTTCGCACACTGTCCATTGAGCCGATTAGAATTGAGG
AGCGCTCCAAAGATGAGGTCCGTGCTAATATATTAGTGTTCGCTGTCACC
TGTGCCCTTATCCGCTTTATTCCGATAATAGTGAGGAAATTATCGTAGTC
AAGACCAAGGATGCGATTGTGTACTTCCGTTTTGACTGAGATAAAGCCGA
ATATATATATTAAAAATATTTAAATATAAACTAATAACAATTAGGTGTTA
TATTAAAAATAAAAACAAAAAAATATGTCGCTAAAATTGAAAAAAAAAAA
AAAAAAA
MIP29362.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 22052426..22052709 | 389..106 | 1420 | 100 | Minus |
chr2L | 23010047 | chr2L | 22052764..22052868 | 105..1 | 495 | 98.1 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 22053833..22054117 | 390..106 | 1425 | 100 | Minus |
2L | 23513712 | 2L | 22054172..22054276 | 105..1 | 525 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:06:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 22053833..22054117 | 390..106 | 1425 | 100 | Minus |
2L | 23513712 | 2L | 22054172..22054276 | 105..1 | 525 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 22:15:27 has no hits.
MIP29362.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:16:10 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 22052764..22052868 | 1..105 | 98 | | Minus |
chr2L | 22052516..22052709 | 106..299 | 100 | <- | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 15:01:29 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 1..138 | 111..248 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:53:09 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 1..138 | 111..248 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:39 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 1..138 | 111..248 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 15:01:29 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 1..309 | 32..340 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:53:09 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 27..415 | 1..389 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:39 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 27..415 | 1..389 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:10 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 22053834..22054117 | 106..389 | 100 | <- | Minus |
2L | 22054172..22054276 | 1..105 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:10 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 22053834..22054117 | 106..389 | 100 | <- | Minus |
2L | 22054172..22054276 | 1..105 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:10 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 22053834..22054117 | 106..389 | 100 | <- | Minus |
2L | 22054172..22054276 | 1..105 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:53:09 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 22053834..22054117 | 106..389 | 100 | <- | Minus |
arm_2L | 22054172..22054276 | 1..105 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:56:57 Download gff for
MIP29362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 22053834..22054117 | 106..389 | 100 | <- | Minus |
2L | 22054172..22054276 | 1..105 | 100 | | Minus |
MIP29362.hyp Sequence
Translation from 110 to 247
> MIP29362.hyp
MFRTLSIEPIRIEERSKDEVRANILVFAVTCALIRFIPIIVRKLS*
MIP29362.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34173-PA | 45 | CG34173-PA | 1..45 | 1..45 | 216 | 100 | Plus |
MIP29362.pep Sequence
Translation from 110 to 247
> MIP29362.pep
MFRTLSIEPIRIEERSKDEVRANILVFAVTCALIRFIPIIVRKLS*
MIP29362.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34173-PA | 45 | CG34173-PA | 1..45 | 1..45 | 216 | 100 | Plus |