Clone MIP29362 Report

Search the DGRC for MIP29362

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:293
Well:62
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34173-RA
Protein status:MIP29362.pep: gold
Sequenced Size:407

Clone Sequence Records

MIP29362.complete Sequence

407 bp assembled on 2011-03-01

GenBank Submission: BT126116.1

> MIP29362.complete
TTTTTTCCCGCCTATGTTCTATATTTAAATCGTTTGAATAGGTTACCCAA
CCACAACACATAAGTGAAGAAAGACAAAATCTTCTAAATTAGTTAAGCAA
TCTATTCAAGATGTTTCGCACACTGTCCATTGAGCCGATTAGAATTGAGG
AGCGCTCCAAAGATGAGGTCCGTGCTAATATATTAGTGTTCGCTGTCACC
TGTGCCCTTATCCGCTTTATTCCGATAATAGTGAGGAAATTATCGTAGTC
AAGACCAAGGATGCGATTGTGTACTTCCGTTTTGACTGAGATAAAGCCGA
ATATATATATTAAAAATATTTAAATATAAACTAATAACAATTAGGTGTTA
TATTAAAAATAAAAACAAAAAAATATGTCGCTAAAATTGAAAAAAAAAAA
AAAAAAA

MIP29362.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22052426..22052709 389..106 1420 100 Minus
chr2L 23010047 chr2L 22052764..22052868 105..1 495 98.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22053833..22054117 390..106 1425 100 Minus
2L 23513712 2L 22054172..22054276 105..1 525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22053833..22054117 390..106 1425 100 Minus
2L 23513712 2L 22054172..22054276 105..1 525 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:15:27 has no hits.

MIP29362.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:16:10 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22052764..22052868 1..105 98   Minus
chr2L 22052516..22052709 106..299 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 15:01:29 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 1..138 111..248 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:53:09 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 1..138 111..248 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:39 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 1..138 111..248 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 15:01:29 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 1..309 32..340 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:53:09 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 27..415 1..389 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:39 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 27..415 1..389 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:10 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22053834..22054117 106..389 100 <- Minus
2L 22054172..22054276 1..105 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:10 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22053834..22054117 106..389 100 <- Minus
2L 22054172..22054276 1..105 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:10 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22053834..22054117 106..389 100 <- Minus
2L 22054172..22054276 1..105 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:53:09 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22053834..22054117 106..389 100 <- Minus
arm_2L 22054172..22054276 1..105 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:56:57 Download gff for MIP29362.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22053834..22054117 106..389 100 <- Minus
2L 22054172..22054276 1..105 100   Minus

MIP29362.hyp Sequence

Translation from 110 to 247

> MIP29362.hyp
MFRTLSIEPIRIEERSKDEVRANILVFAVTCALIRFIPIIVRKLS*

MIP29362.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34173-PA 45 CG34173-PA 1..45 1..45 216 100 Plus

MIP29362.pep Sequence

Translation from 110 to 247

> MIP29362.pep
MFRTLSIEPIRIEERSKDEVRANILVFAVTCALIRFIPIIVRKLS*

MIP29362.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34173-PA 45 CG34173-PA 1..45 1..45 216 100 Plus