Clone MIP29370 Report

Search the DGRC for MIP29370

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:293
Well:70
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42866-RA
Protein status:MIP29370.pep: gold
Sequenced Size:429

Clone Sequence Records

MIP29370.complete Sequence

429 bp assembled on 2011-03-01

GenBank Submission: BT126106.1

> MIP29370.complete
AGTCGCCAGTCTATTGTTTCCCAATGCGGTTGATTTTTTTCTGCTTGTGC
CTCTTTTTGTCCCTGGAGCTAGTAGTGCCCAGACATGTCGTGGGCCACGA
TGGATACCACAACATCGAGAAGGAAAAGCGCTGGAAAAACTGGCCAGCAC
GTGTGAGGCACCACCATAAACAACGTAACTCCATCTGATGTCCGACAAGG
TTGGGATTGCACGCGATTACTTATGGCCCGTTGCAAAGTCGTTCACAGGG
CCATAATGCCTCGGATCTCGCCAGACAATGGGAAGCGGAAGCCTTGTTCA
TCATATCAATGGATCACTGCTTAATTGAACATTTCCACTGTTCGAATGTG
TAAATAATAAATTGAATCGCATTAATTGTTGCTATCCAAGCGATATACAT
TTCAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP29370.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19959565..19959921 403..47 1770 99.7 Minus
chr2L 23010047 chr2L 19959980..19960026 47..1 220 97.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19961221..19961580 406..47 1800 100 Minus
2L 23513712 2L 19961639..19961685 47..1 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19961221..19961580 406..47 1800 100 Minus
2L 23513712 2L 19961639..19961685 47..1 235 100 Minus
Blast to na_te.dros performed 2019-03-17 01:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 3002..3041 131..172 115 78.6 Plus

MIP29370.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:47:25 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19959565..19959920 48..403 99 <- Minus
chr2L 19959980..19960026 1..47 97   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 10:32:34 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 1..165 24..188 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:08 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 1..165 24..188 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:29 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 1..165 24..188 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 10:32:34 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 1..353 24..376 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:08 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 1..403 1..403 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:29 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 1..403 1..403 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:25 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961224..19961579 48..403 100 <- Minus
2L 19961639..19961685 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:25 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961224..19961579 48..403 100 <- Minus
2L 19961639..19961685 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:25 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961224..19961579 48..403 100 <- Minus
2L 19961639..19961685 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:08 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19961224..19961579 48..403 100 <- Minus
arm_2L 19961639..19961685 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:15 Download gff for MIP29370.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961224..19961579 48..403 100 <- Minus
2L 19961639..19961685 1..47 100   Minus

MIP29370.hyp Sequence

Translation from 2 to 187

> MIP29370.hyp
SPVYCFPMRLIFFCLCLFLSLELVVPRHVVGHDGYHNIEKEKRWKNWPAR
VRHHHKQRNSI*

MIP29370.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42866-PA 54 CG42866-PA 1..54 8..61 306 100 Plus

MIP29370.pep Sequence

Translation from 2 to 187

> MIP29370.pep
SPVYCFPMRLIFFCLCLFLSLELVVPRHVVGHDGYHNIEKEKRWKNWPAR
VRHHHKQRNSI*

MIP29370.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42866-PA 54 CG42866-PA 1..54 8..61 306 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16977-PA 54 GM16977-PA 19..54 26..61 169 88.9 Plus
Dsec\GM18814-PA 101 GM18814-PA 1..42 8..49 131 88.1 Plus
Dsec\GM11934-PA 101 GM11934-PA 1..42 8..49 131 88.1 Plus