Clone MIP29410 Report

Search the DGRC for MIP29410

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:294
Well:10
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43101-RA
Protein status:MIP29410.pep: gold
Sequenced Size:434

Clone Sequence Records

MIP29410.complete Sequence

434 bp assembled on 2011-03-01

GenBank Submission: BT126107.1

> MIP29410.complete
ACTCTTCAAATTTAGCCTTCAAAATGATCAAGTTTTTTGCCGTGGTTGTC
TTGCTGGCCATAAGTCCGCTATCGTCTGATTCTACTCTAATTGACATTGT
GTCTAGTTGTATAAATTTTCAGTTTAAGGCATTACTATACCTTGCGGAAT
CAACTGATGATAAATTTCATTGTATTGAAACATGTGTATATGATATTATC
AGAAATCTTACAAAGATTGATCTACCTAAACGCCCGGATCCCGAAATATG
TCAAGGCTTAAATGACAAATGTAAGTACGCCGAAGGATTACGAAAGTGTC
TTCCACCAAATTTAGATGAAAGATTTTGGAAAGATGTTTTTACACGAATA
TAAACTTTAGACTAAACTTGTAACTTTGGTACAATAAAATAATAAATCTC
GCTTCACAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP29410.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10900300..10900616 406..90 1585 100 Minus
chr2R 21145070 chr2R 10900688..10900776 89..1 445 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15013041..15013362 411..90 1595 99.7 Minus
2R 25286936 2R 15013434..15013522 89..1 445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15014240..15014561 411..90 1595 99.6 Minus
2R 25260384 2R 15014633..15014721 89..1 445 100 Minus
Blast to na_te.dros performed on 2019-03-17 01:46:15 has no hits.

MIP29410.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:47:26 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10900299..10900616 90..407 99 <- Minus
chr2R 10900688..10900776 1..89 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 10:32:35 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 1..330 24..353 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:10 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 1..330 24..353 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:32 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 1..330 24..353 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 10:32:35 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 1..330 24..353 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:10 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:32 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 1..405 1..405 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:26 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15013045..15013362 90..407 99 <- Minus
2R 15013434..15013522 1..89 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:26 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15013045..15013362 90..407 99 <- Minus
2R 15013434..15013522 1..89 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:26 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15013045..15013362 90..407 99 <- Minus
2R 15013434..15013522 1..89 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:10 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10900550..10900867 90..407 99 <- Minus
arm_2R 10900939..10901027 1..89 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:16 Download gff for MIP29410.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15014244..15014561 90..407 99 <- Minus
2R 15014633..15014721 1..89 100   Minus

MIP29410.hyp Sequence

Translation from 2 to 352

> MIP29410.hyp
SSNLAFKMIKFFAVVVLLAISPLSSDSTLIDIVSSCINFQFKALLYLAES
TDDKFHCIETCVYDIIRNLTKIDLPKRPDPEICQGLNDKCKYAEGLRKCL
PPNLDERFWKDVFTRI*

MIP29410.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43101-PA 109 CG43101-PA 1..109 8..116 577 100 Plus

MIP29410.pep Sequence

Translation from 23 to 352

> MIP29410.pep
MIKFFAVVVLLAISPLSSDSTLIDIVSSCINFQFKALLYLAESTDDKFHC
IETCVYDIIRNLTKIDLPKRPDPEICQGLNDKCKYAEGLRKCLPPNLDER
FWKDVFTRI*

MIP29410.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG43101-PA 109 CG43101-PA 1..109 1..109 577 100 Plus