Clone MIP29416 Report

Search the DGRC for MIP29416

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:294
Well:16
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG14069-RA
Protein status:MIP29416.pep: gold
Sequenced Size:396

Clone Sequence Records

MIP29416.complete Sequence

396 bp assembled on 2011-03-01

GenBank Submission: BT126243.1

> MIP29416.complete
ATGAACACAGCGACCACAATTGCCATCGGATTGTTAATGTTCATCCCACT
GATCCTGATGCAGCTGGACCCTCAAATAGCCAACTGGTCGGCTCAAATAG
CACTGGAGCTTCAGGAGCAGCCGGACAAGTTGGCCTATTGTCGTTCGCTT
CAGCAACAGAAGCTGCGAATACCGCTCCAAAACACTGGATGTGCCACCAT
TCTGAGCAACCAGCTCGGCGTGACAGGTGAAATGCTACTCGAGATTCAAA
AGCGTTGCTGGGCCGGATGGGGTCTCCTGGCAGGACGATGTCGCAAGTTG
GCCTAGACTTTAAGGTGATTCGAAATATCCCAAAACCTTGTAGCTAACTG
AAATAAAGAACACAATGGCAGGCAAAAAAAAAAAAAAAAAAAAAAA

MIP29416.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10908937..10909309 373..1 1865 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10910161..10910535 375..1 1875 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10910161..10910535 375..1 1875 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:15:09 has no hits.

MIP29416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:16:00 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10908937..10909309 1..373 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 13:26:21 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
CG14069-RA 1..306 1..306 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:54 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
CG14069-RA 1..306 1..306 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:24 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
CG14069-RA 1..306 1..306 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 13:26:21 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
CG14069-RA 1..306 1..306 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:54 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
CG14069-RA 7..379 1..373 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:24 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
CG14069-RA 7..379 1..373 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:00 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10910163..10910535 1..373 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:00 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10910163..10910535 1..373 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:00 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10910163..10910535 1..373 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:54 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10910163..10910535 1..373 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:19 Download gff for MIP29416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10910163..10910535 1..373 100   Minus

MIP29416.pep Sequence

Translation from 0 to 305

> MIP29416.pep
MNTATTIAIGLLMFIPLILMQLDPQIANWSAQIALELQEQPDKLAYCRSL
QQQKLRIPLQNTGCATILSNQLGVTGEMLLEIQKRCWAGWGLLAGRCRKL
A*

MIP29416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19653-PA 106 GF19653-PA 1..106 1..101 259 49.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10342-PA 101 GG10342-PA 1..101 1..101 453 89.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13945-PA 90 GH13945-PA 22..90 30..101 169 47.2 Plus
Dgri\GH11689-PA 90 GH11689-PA 22..90 30..101 169 47.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14069-PB 101 CG14069-PB 1..101 1..101 522 100 Plus
CG14069-PA 101 CG14069-PA 1..101 1..101 522 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17134-PA 102 GI17134-PA 32..102 30..101 186 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19024-PA 105 GL19024-PA 1..103 1..99 231 50.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12740-PA 105 GA12740-PA 1..103 1..99 229 49.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11281-PA 101 GM11281-PA 1..101 1..101 475 93.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22210-PA 101 GD22210-PA 1..101 1..101 478 94.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16172-PA 99 GJ16172-PA 14..97 11..99 211 46.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13165-PA 101 GE13165-PA 1..101 1..101 458 90.1 Plus

MIP29416.hyp Sequence

Translation from 1 to 305

> MIP29416.hyp
MNTATTIAIGLLMFIPLILMQLDPQIANWSAQIALELQEQPDKLAYCRSL
QQQKLRIPLQNTGCATILSNQLGVTGEMLLEIQKRCWAGWGLLAGRCRKL
A*

MIP29416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14069-PB 101 CG14069-PB 1..101 1..101 522 100 Plus
CG14069-PA 101 CG14069-PA 1..101 1..101 522 100 Plus