BDGP Sequence Production Resources |
Search the DGRC for MIP29911
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 299 |
Well: | 11 |
Vector: | pOT2 |
Associated Gene/Transcript | Eig71Ea-RA |
Protein status: | MIP29911.pep: gold |
Sequenced Size: | 410 |
410 bp assembled on 2011-03-30
GenBank Submission: BT126196.1
> MIP29911.complete TTCCCATAGTGAGAGAGTTTAAACTACAATAATGCGCCTGAAAACAGTTT TAACCATCTTTTTCGCCATATCGCTGACTCTGGTTGCTGGTCAAGATCGG GACTGTGATGAATTGGCAAGGAGATGTGAATCCTGTGTGAGGCGTCTAAA TAATACAATCGATCGCGATTTACCCCTCTTCAATAGAGAGTGCAGACAAA GGACCGAATTATCTTGGCGCTGGAGGAACGTCGGACGCTGTGAGCTCTCC AAGCTAAATTGCTTGGGTTGGCAATCACCCATGAACTGTGAAGACATTGC TATGAGGGCTGGTATGGAACGCAGGCGTACTTAATAGTTATCCACTAATG CATAAATGAAATGATTAAAAAAAAAATAAAAAGAGCATCGAAGTAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15639217..15639420 | 268..65 | 1020 | 100 | Minus |
chr3L | 24539361 | chr3L | 15639027..15639156 | 394..266 | 585 | 98.5 | Minus |
chr3L | 24539361 | chr3L | 15639481..15639545 | 65..1 | 325 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 15649315..15649518 | 268..65 | 1020 | 100 | Minus |
3L | 28110227 | 3L | 15649120..15649254 | 400..266 | 675 | 100 | Minus |
3L | 28110227 | 3L | 15649579..15649643 | 65..1 | 325 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 15642415..15642618 | 268..65 | 1020 | 100 | Minus |
3L | 28103327 | 3L | 15642220..15642354 | 400..266 | 675 | 100 | Minus |
3L | 28103327 | 3L | 15642679..15642743 | 65..1 | 325 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 6654..6700 | 333..378 | 106 | 72.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15639027..15639155 | 267..394 | 98 | <- | Minus |
chr3L | 15639219..15639419 | 66..266 | 100 | <- | Minus |
chr3L | 15639481..15639545 | 1..65 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ea-RA | 1..303 | 32..334 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ea-RA | 1..303 | 32..334 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ea-RA | 1..303 | 32..334 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ea-RA | 19..412 | 1..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ea-RA | 19..412 | 1..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ea-RA | 19..412 | 1..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15649126..15649253 | 267..394 | 100 | <- | Minus |
3L | 15649317..15649517 | 66..266 | 100 | <- | Minus |
3L | 15649579..15649643 | 1..65 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15649126..15649253 | 267..394 | 100 | <- | Minus |
3L | 15649317..15649517 | 66..266 | 100 | <- | Minus |
3L | 15649579..15649643 | 1..65 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15649126..15649253 | 267..394 | 100 | <- | Minus |
3L | 15649317..15649517 | 66..266 | 100 | <- | Minus |
3L | 15649579..15649643 | 1..65 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15642226..15642353 | 267..394 | 100 | <- | Minus |
arm_3L | 15642417..15642617 | 66..266 | 100 | <- | Minus |
arm_3L | 15642679..15642743 | 1..65 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15642417..15642617 | 66..266 | 100 | <- | Minus |
3L | 15642679..15642743 | 1..65 | 100 | Minus | |
3L | 15642226..15642353 | 267..394 | 100 | <- | Minus |
Translation from 31 to 333
> MIP29911.pep MRLKTVLTIFFAISLTLVAGQDRDCDELARRCESCVRRLNNTIDRDLPLF NRECRQRTELSWRWRNVGRCELSKLNCLGWQSPMNCEDIAMRAGMERRRT *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10385-PA | 102 | GF10385-PA | 1..101 | 1..98 | 298 | 56.4 | Plus |
Dana\GF24087-PA | 73 | GF24087-PA | 1..68 | 28..95 | 209 | 57.4 | Plus |
Dana\GF10381-PA | 99 | GF10381-PA | 1..99 | 1..100 | 178 | 35 | Plus |
Dana\GF10380-PA | 101 | GF10380-PA | 1..98 | 1..99 | 152 | 32.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13530-PA | 100 | GG13530-PA | 1..99 | 1..99 | 425 | 81.8 | Plus |
Dere\GG15918-PA | 99 | GG15918-PA | 1..97 | 1..97 | 314 | 62.9 | Plus |
Dere\GG13527-PA | 98 | GG13527-PA | 1..97 | 1..98 | 155 | 32.7 | Plus |
Dere\GG13526-PA | 101 | GG13526-PA | 1..94 | 3..97 | 144 | 32.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ea-PA | 100 | CG16931-PA | 1..100 | 1..100 | 539 | 100 | Plus |
Eig71Ed-PA | 99 | CG7350-PA | 1..97 | 1..97 | 327 | 59.8 | Plus |
Eig71Ef-PA | 98 | CG7599-PA | 1..97 | 1..98 | 170 | 33.7 | Plus |
Eig71Ej-PA | 98 | CG7588-PA | 1..98 | 1..99 | 159 | 31.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24985-PA | 85 | GL24985-PA | 16..81 | 16..79 | 187 | 57.6 | Plus |
Dper\GL25491-PA | 98 | GL25491-PA | 1..97 | 1..98 | 163 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20285-PA | 100 | GA20285-PA | 1..100 | 1..100 | 263 | 52 | Plus |
Dpse\GA23630-PA | 214 | GA23630-PA | 115..213 | 3..99 | 223 | 47.5 | Plus |
Dpse\GA20470-PA | 98 | GA20470-PA | 1..97 | 1..98 | 169 | 38.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24474-PA | 100 | GM24474-PA | 1..100 | 1..100 | 486 | 91 | Plus |
Dsec\GM25550-PA | 99 | GM25550-PA | 1..97 | 1..97 | 277 | 61.9 | Plus |
Dsec\GM24471-PA | 98 | GM24471-PA | 1..97 | 1..98 | 150 | 32.7 | Plus |
Dsec\GM24470-PA | 98 | GM24470-PA | 1..98 | 1..99 | 133 | 30.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12548-PA | 100 | GD12548-PA | 1..79 | 1..79 | 378 | 89.9 | Plus |
Dsim\GD14563-PA | 99 | GD14563-PA | 1..97 | 1..97 | 273 | 61.9 | Plus |
Dsim\GD12545-PA | 98 | GD12545-PA | 1..97 | 1..98 | 161 | 32.7 | Plus |
Dsim\GD12544-PA | 101 | GD12544-PA | 1..94 | 3..97 | 135 | 30.5 | Plus |
Dsim\GD12543-PA | 98 | GD12543-PA | 1..98 | 1..99 | 133 | 30.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15124-PA | 144 | GK15124-PA | 1..98 | 1..98 | 236 | 46.9 | Plus |
Dwil\GK20696-PA | 102 | GK20696-PA | 9..99 | 7..99 | 157 | 38.7 | Plus |
Dwil\GK20707-PA | 100 | GK20707-PA | 3..99 | 6..98 | 138 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22833-PA | 100 | GE22833-PA | 1..99 | 1..99 | 463 | 89.9 | Plus |
Dyak\GE19825-PA | 100 | GE19825-PA | 1..99 | 1..99 | 460 | 89.9 | Plus |
Dyak\GE23155-PA | 100 | GE23155-PA | 1..97 | 1..97 | 330 | 66 | Plus |
Dyak\GE22265-PA | 100 | GE22265-PA | 1..97 | 1..97 | 326 | 64.9 | Plus |
Dyak\GE22830-PA | 98 | GE22830-PA | 1..97 | 1..98 | 155 | 33.7 | Plus |
Translation from 31 to 333
> MIP29911.hyp MRLKTVLTIFFAISLTLVAGQDRDCDELARRCESCVRRLNNTIDRDLPLF NRECRQRTELSWRWRNVGRCELSKLNCLGWQSPMNCEDIAMRAGMERRRT *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ea-PA | 100 | CG16931-PA | 1..100 | 1..100 | 539 | 100 | Plus |
Eig71Ed-PA | 99 | CG7350-PA | 1..97 | 1..97 | 327 | 59.8 | Plus |
Eig71Ef-PA | 98 | CG7599-PA | 1..97 | 1..98 | 170 | 33.7 | Plus |
Eig71Ej-PA | 98 | CG7588-PA | 1..98 | 1..99 | 159 | 31.3 | Plus |