Clone MIP29911 Report

Search the DGRC for MIP29911

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:299
Well:11
Vector:pOT2
Associated Gene/TranscriptEig71Ea-RA
Protein status:MIP29911.pep: gold
Sequenced Size:410

Clone Sequence Records

MIP29911.complete Sequence

410 bp assembled on 2011-03-30

GenBank Submission: BT126196.1

> MIP29911.complete
TTCCCATAGTGAGAGAGTTTAAACTACAATAATGCGCCTGAAAACAGTTT
TAACCATCTTTTTCGCCATATCGCTGACTCTGGTTGCTGGTCAAGATCGG
GACTGTGATGAATTGGCAAGGAGATGTGAATCCTGTGTGAGGCGTCTAAA
TAATACAATCGATCGCGATTTACCCCTCTTCAATAGAGAGTGCAGACAAA
GGACCGAATTATCTTGGCGCTGGAGGAACGTCGGACGCTGTGAGCTCTCC
AAGCTAAATTGCTTGGGTTGGCAATCACCCATGAACTGTGAAGACATTGC
TATGAGGGCTGGTATGGAACGCAGGCGTACTTAATAGTTATCCACTAATG
CATAAATGAAATGATTAAAAAAAAAATAAAAAGAGCATCGAAGTAAAAAA
AAAAAAAAAA

MIP29911.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15639217..15639420 268..65 1020 100 Minus
chr3L 24539361 chr3L 15639027..15639156 394..266 585 98.5 Minus
chr3L 24539361 chr3L 15639481..15639545 65..1 325 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15649315..15649518 268..65 1020 100 Minus
3L 28110227 3L 15649120..15649254 400..266 675 100 Minus
3L 28110227 3L 15649579..15649643 65..1 325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15642415..15642618 268..65 1020 100 Minus
3L 28103327 3L 15642220..15642354 400..266 675 100 Minus
3L 28103327 3L 15642679..15642743 65..1 325 100 Minus
Blast to na_te.dros performed 2019-03-16 22:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 6654..6700 333..378 106 72.3 Plus

MIP29911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:54:09 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15639027..15639155 267..394 98 <- Minus
chr3L 15639219..15639419 66..266 100 <- Minus
chr3L 15639481..15639545 1..65 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:18 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ea-RA 1..303 32..334 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:04 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ea-RA 1..303 32..334 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:32:19 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ea-RA 1..303 32..334 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:17 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ea-RA 19..412 1..394 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:04 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ea-RA 19..412 1..394 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:19 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ea-RA 19..412 1..394 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:09 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15649126..15649253 267..394 100 <- Minus
3L 15649317..15649517 66..266 100 <- Minus
3L 15649579..15649643 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:09 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15649126..15649253 267..394 100 <- Minus
3L 15649317..15649517 66..266 100 <- Minus
3L 15649579..15649643 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:09 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15649126..15649253 267..394 100 <- Minus
3L 15649317..15649517 66..266 100 <- Minus
3L 15649579..15649643 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:04 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15642226..15642353 267..394 100 <- Minus
arm_3L 15642417..15642617 66..266 100 <- Minus
arm_3L 15642679..15642743 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:03:50 Download gff for MIP29911.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15642417..15642617 66..266 100 <- Minus
3L 15642679..15642743 1..65 100   Minus
3L 15642226..15642353 267..394 100 <- Minus

MIP29911.pep Sequence

Translation from 31 to 333

> MIP29911.pep
MRLKTVLTIFFAISLTLVAGQDRDCDELARRCESCVRRLNNTIDRDLPLF
NRECRQRTELSWRWRNVGRCELSKLNCLGWQSPMNCEDIAMRAGMERRRT
*

MIP29911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10385-PA 102 GF10385-PA 1..101 1..98 298 56.4 Plus
Dana\GF24087-PA 73 GF24087-PA 1..68 28..95 209 57.4 Plus
Dana\GF10381-PA 99 GF10381-PA 1..99 1..100 178 35 Plus
Dana\GF10380-PA 101 GF10380-PA 1..98 1..99 152 32.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13530-PA 100 GG13530-PA 1..99 1..99 425 81.8 Plus
Dere\GG15918-PA 99 GG15918-PA 1..97 1..97 314 62.9 Plus
Dere\GG13527-PA 98 GG13527-PA 1..97 1..98 155 32.7 Plus
Dere\GG13526-PA 101 GG13526-PA 1..94 3..97 144 32.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ea-PA 100 CG16931-PA 1..100 1..100 539 100 Plus
Eig71Ed-PA 99 CG7350-PA 1..97 1..97 327 59.8 Plus
Eig71Ef-PA 98 CG7599-PA 1..97 1..98 170 33.7 Plus
Eig71Ej-PA 98 CG7588-PA 1..98 1..99 159 31.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24985-PA 85 GL24985-PA 16..81 16..79 187 57.6 Plus
Dper\GL25491-PA 98 GL25491-PA 1..97 1..98 163 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20285-PA 100 GA20285-PA 1..100 1..100 263 52 Plus
Dpse\GA23630-PA 214 GA23630-PA 115..213 3..99 223 47.5 Plus
Dpse\GA20470-PA 98 GA20470-PA 1..97 1..98 169 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24474-PA 100 GM24474-PA 1..100 1..100 486 91 Plus
Dsec\GM25550-PA 99 GM25550-PA 1..97 1..97 277 61.9 Plus
Dsec\GM24471-PA 98 GM24471-PA 1..97 1..98 150 32.7 Plus
Dsec\GM24470-PA 98 GM24470-PA 1..98 1..99 133 30.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12548-PA 100 GD12548-PA 1..79 1..79 378 89.9 Plus
Dsim\GD14563-PA 99 GD14563-PA 1..97 1..97 273 61.9 Plus
Dsim\GD12545-PA 98 GD12545-PA 1..97 1..98 161 32.7 Plus
Dsim\GD12544-PA 101 GD12544-PA 1..94 3..97 135 30.5 Plus
Dsim\GD12543-PA 98 GD12543-PA 1..98 1..99 133 30.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15124-PA 144 GK15124-PA 1..98 1..98 236 46.9 Plus
Dwil\GK20696-PA 102 GK20696-PA 9..99 7..99 157 38.7 Plus
Dwil\GK20707-PA 100 GK20707-PA 3..99 6..98 138 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22833-PA 100 GE22833-PA 1..99 1..99 463 89.9 Plus
Dyak\GE19825-PA 100 GE19825-PA 1..99 1..99 460 89.9 Plus
Dyak\GE23155-PA 100 GE23155-PA 1..97 1..97 330 66 Plus
Dyak\GE22265-PA 100 GE22265-PA 1..97 1..97 326 64.9 Plus
Dyak\GE22830-PA 98 GE22830-PA 1..97 1..98 155 33.7 Plus

MIP29911.hyp Sequence

Translation from 31 to 333

> MIP29911.hyp
MRLKTVLTIFFAISLTLVAGQDRDCDELARRCESCVRRLNNTIDRDLPLF
NRECRQRTELSWRWRNVGRCELSKLNCLGWQSPMNCEDIAMRAGMERRRT
*

MIP29911.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ea-PA 100 CG16931-PA 1..100 1..100 539 100 Plus
Eig71Ed-PA 99 CG7350-PA 1..97 1..97 327 59.8 Plus
Eig71Ef-PA 98 CG7599-PA 1..97 1..98 170 33.7 Plus
Eig71Ej-PA 98 CG7588-PA 1..98 1..99 159 31.3 Plus