Clone Sequence Records
MIP29914.complete Sequence
327 bp assembled on 2011-04-05
GenBank Submission: BT126252.1
> MIP29914.complete
TTGGACCCAACCGCACGGTTTTCAAAGTTTGCAAAAATATCTGAATAATG
CCACCACCACACGGAGGACCCGGAGGCCATGGACATGGAGGACCGCATCA
TGGCGGACCCCCGCATCATGGAGGCCACCATGGACCGCCACATCACCATG
GACCGCCCCATCATCACCACGGACCTCGTCCCTGCTGCCTTTGCTGCACA
ATTTCATAAGAATTTATAAAGGAATTTATTAAAGATTGTAGTTTTAAGAA
CCCTCACGTAATAAATACGAATGCCCCGAAGAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA
MIP29914.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:56:18
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chr2R | 21145070 | chr2R | 15578010..15578299 | 1..281 | 1280 | 96.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:56:16
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 19690798..19691078 | 1..281 | 1405 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25260384 | 2R | 19691997..19692277 | 1..281 | 1405 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 22:56:17 has no hits.
MIP29914.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:57:20 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chr2R | 15578010..15578299 | 1..281 | 96 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-07 17:26:30 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15126-RA | 1..162 | 48..209 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:01:34 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15126-RA | 1..162 | 48..209 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:33:41 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15126-RA | 1..162 | 48..209 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-07 17:26:30 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15126-RA | 1..162 | 48..209 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:01:34 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15126-RA | 1..281 | 1..281 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:33:41 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15126-RA | 1..281 | 1..281 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:57:20 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 19690798..19691078 | 1..281 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:57:20 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 19690798..19691078 | 1..281 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:57:20 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 19690798..19691078 | 1..281 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:01:34 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 15578303..15578583 | 1..281 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:13 Download gff for
MIP29914.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 19691997..19692277 | 1..281 | 100 | | Plus |
MIP29914.hyp Sequence
Translation from 0 to 231
> MIP29914.hyp
WTQPHGFQSLQKYLNNATTTRRTRRPWTWRTASWRTPASWRPPWTATSPW
TAPSSPRTSSLLPLLHNFIRIYKGIY*
Sequence MIP29914.hyp has no blast hits.
MIP29914.pep Sequence
Translation from 47 to 208
> MIP29914.pep
MPPPHGGPGGHGHGGPHHGGPPHHGGHHGPPHHHGPPHHHHGPRPCCLCC
TIS*
MIP29914.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG15126-PA | 53 | CG15126-PA | 1..53 | 1..53 | 366 | 100 | Plus |
| CG43349-PB | 70 | CG43349-PB | 15..60 | 3..43 | 172 | 70.2 | Plus |
| CG43349-PA | 70 | CG43349-PA | 15..60 | 3..43 | 172 | 70.2 | Plus |
| CG43349-PB | 70 | CG43349-PB | 1..50 | 1..43 | 168 | 64.7 | Plus |
| CG43349-PA | 70 | CG43349-PA | 1..50 | 1..43 | 168 | 64.7 | Plus |
| CG43349-PB | 70 | CG43349-PB | 20..63 | 3..39 | 156 | 63.6 | Plus |
| CG43349-PA | 70 | CG43349-PA | 20..63 | 3..39 | 156 | 63.6 | Plus |
| CG43349-PB | 70 | CG43349-PB | 25..68 | 3..39 | 147 | 61.4 | Plus |
| CG43349-PA | 70 | CG43349-PA | 25..68 | 3..39 | 147 | 61.4 | Plus |
| CG13482-PA | 102 | CG13482-PA | 20..71 | 9..45 | 132 | 51.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:05:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM21980-PA | 57 | GM21980-PA | 1..57 | 1..53 | 160 | 86 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:05:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsim\GD11476-PA | 57 | GD11476-PA | 1..57 | 1..53 | 167 | 87.7 | Plus |
