Clone MIP29918 Report

Search the DGRC for MIP29918

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:299
Well:18
Vector:pOT2
Associated Gene/TranscriptCpr49Af-RA
Protein status:MIP29918.pep: gold
Sequenced Size:538

Clone Sequence Records

MIP29918.complete Sequence

538 bp assembled on 2011-03-30

GenBank Submission: BT126197.1

> MIP29918.complete
AGACACCAGCTTGGATTGCATTGCAGTGATATCGATATAGAGCGGAATAG
AGATCCCGTCATGAAGTACCTAATGTTAATTGCCCTTTTTGTGGTCGCTG
CTTCGGCGACGGACAACGATGATCCGATTTCCCAGGAATCCAATGTGGAG
TACAATGGCAAATACCATTATCATTATGAGCTCAAAGATGGCTCGAAGGC
CACTCAGGATGGAGTCTTGAAGTCCGTGAATGCCGATCACAACGGGGAGT
CGGTCAATGGAAAGTACTCCTTCGTCGCCGACGATGGAAAGACCTATGTT
GTGTCCTACACGGCGGACGAGAACGGATACCTTGCGGTGGGTGACCACCT
GCCCACACCGCCACCCACGCCGGTGTCCGTTCTGAAGGCTCTGGAGTACA
TCCGCCTGCATCCGTACAAGACGCCCGAGCAGAAGCAATAATCAGCCCGC
TAGAACTAAGCCAGAATGTGATTGGAACCAAAAGAACTGAGAAAAATATT
AAAAGATAATATCGAAAAACAAAAAAAAAAAAAAAAAA

MIP29918.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8293417..8293763 174..520 1735 100 Plus
chr2R 21145070 chr2R 8293186..8293358 1..173 835 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12406176..12406524 174..522 1745 100 Plus
2R 25286936 2R 12405945..12406117 1..173 865 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12407375..12407723 174..522 1745 100 Plus
2R 25260384 2R 12407144..12407316 1..173 865 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:53:36 has no hits.

MIP29918.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:54:16 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8293186..8293358 1..173 98 -> Plus
chr2R 8293417..8293763 174..520 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:20 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 1..381 61..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:13 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 1..381 61..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:32:29 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 1..381 61..441 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:20 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 1..381 61..441 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:13 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 14..533 1..520 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:29 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 14..533 1..520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:16 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12405945..12406117 1..173 100 -> Plus
2R 12406176..12406522 174..520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:16 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12405945..12406117 1..173 100 -> Plus
2R 12406176..12406522 174..520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:16 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12405945..12406117 1..173 100 -> Plus
2R 12406176..12406522 174..520 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:13 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8293450..8293622 1..173 100 -> Plus
arm_2R 8293681..8294027 174..520 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:03:54 Download gff for MIP29918.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12407375..12407721 174..520 100   Plus
2R 12407144..12407316 1..173 100 -> Plus

MIP29918.pep Sequence

Translation from 0 to 440

> MIP29918.pep
RHQLGLHCSDIDIERNRDPVMKYLMLIALFVVAASATDNDDPISQESNVE
YNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYV
VSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHPYKTPEQKQ*

MIP29918.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12858-PA 128 GF12858-PA 1..127 21..145 542 81.9 Plus
Dana\GF24202-PA 115 GF24202-PA 1..112 20..145 206 41.1 Plus
Dana\GF10617-PA 121 GF10617-PA 1..115 20..139 196 39 Plus
Dana\GF10921-PA 101 GF10921-PA 1..99 21..121 195 41.5 Plus
Dana\GF10925-PA 107 GF10925-PA 34..107 55..127 192 51.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20294-PA 126 GG20294-PA 1..126 21..146 626 94.4 Plus
Dere\GG13245-PA 121 GG13245-PA 1..120 20..146 215 39.2 Plus
Dere\GG15456-PA 134 GG15456-PA 34..131 47..146 195 38.7 Plus
Dere\GG15458-PA 134 GG15458-PA 34..131 47..146 195 38.7 Plus
Dere\GG15459-PA 122 GG15459-PA 1..122 20..146 192 35.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20699-PA 126 GH20699-PA 1..125 21..146 367 55.6 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..113 20..138 216 38.5 Plus
Dgri\GH15650-PA 101 GH15650-PA 1..97 21..118 193 46.5 Plus
Dgri\GH15651-PA 99 GH15651-PA 1..98 21..119 185 42 Plus
Dgri\GH15299-PA 118 GH15299-PA 8..117 24..140 184 35.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Af-PB 126 CG8510-PB 1..126 21..146 666 100 Plus
Cpr49Af-PA 126 CG8510-PA 1..126 21..146 666 100 Plus
Cpr49Aa-PB 144 CG30045-PB 34..135 43..144 224 41.2 Plus
Edg78E-PB 122 CG7673-PB 3..120 22..146 219 39.8 Plus
Edg78E-PA 122 CG7673-PA 3..120 22..146 219 39.8 Plus
Cpr65Ec-PA 127 CG8634-PA 5..124 23..146 214 35.2 Plus
Cpr49Ae-PA 134 CG8505-PA 31..125 43..134 210 43.2 Plus
Lcp65Af-PA 100 CG10533-PA 1..98 21..121 208 47.1 Plus
Cpr67Fb-PA 122 CG18348-PA 1..122 20..146 208 35.4 Plus
Cpr67Fa2-PA 134 CG18349-PA 34..131 47..146 203 38.7 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..117 20..138 203 35.2 Plus
Lcp65Ac-PA 109 CG6956-PA 7..106 24..121 197 46.5 Plus
Cpr65Ea-PA 127 CG8640-PA 3..116 22..144 193 36.3 Plus
Cpr65Az-PA 239 CG12330-PA 117..207 43..132 191 39.6 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..103 21..121 187 40.4 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..103 21..121 187 40.4 Plus
Lcp65Ag3-PA 105 CG18779-PA 1..103 21..121 187 40.4 Plus
Cpr78Cc-PA 119 CG7658-PA 6..116 24..138 186 35.8 Plus
Cpr47Ea-PA 135 CG9079-PA 44..123 43..122 186 40 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..100 21..121 183 40.2 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..100 21..121 183 40.2 Plus
Cpr65Ax1-PA 102 CG34270-PA 1..100 21..121 183 40.2 Plus
Cpr47Ef-PD 601 CG13214-PD 146..225 52..131 181 40 Plus
Cpr47Ef-PC 612 CG13214-PC 146..225 52..131 181 40 Plus
Pcp-PA 184 CG3440-PA 4..119 20..140 179 33.1 Plus
Acp65Aa-PA 105 CG10297-PA 1..104 20..118 177 36.5 Plus
Lcp65Ae-PA 99 CG10529-PA 1..96 21..118 173 41.4 Plus
Lcp65Ad-PB 108 CG6955-PB 1..106 21..120 172 35.8 Plus
Lcp65Ad-PA 108 CG6955-PA 1..106 21..120 172 35.8 Plus
Lcp65Aa-PA 102 CG7287-PA 1..100 21..118 170 36.6 Plus
Lcp4-PB 112 CG2044-PB 4..111 24..140 169 35 Plus
Lcp4-PA 112 CG2044-PA 4..111 24..140 169 35 Plus
Cpr65Eb-PA 179 CG8638-PA 43..126 52..143 166 37 Plus
Cpr49Ah-PA 190 CG8515-PA 63..146 52..134 163 40.5 Plus
Lcp65Ab1-PA 104 CG32400-PA 1..102 21..121 160 35.9 Plus
Lcp65Ab2-PA 104 CG18773-PA 1..102 21..121 160 35.9 Plus
Cpr11B-PB 195 CG2555-PB 73..155 43..126 158 35.7 Plus
Cpr11B-PA 197 CG2555-PA 73..155 43..126 158 35.7 Plus
Lcp3-PB 112 CG2043-PB 42..111 70..140 155 43.7 Plus
Lcp3-PA 112 CG2043-PA 42..111 70..140 155 43.7 Plus
Cpr49Ab-PA 259 CG30042-PA 162..251 43..134 154 37 Plus
Lcp2-PB 126 CG8697-PB 1..117 20..138 151 27 Plus
Lcp2-PA 126 CG8697-PA 1..117 20..138 151 27 Plus
Cpr47Eg-PA 117 CG9070-PA 1..114 21..138 150 32.8 Plus
Cpr65Av-PA 111 CG32405-PA 46..109 55..118 149 43.8 Plus
Cpr100A-PA 241 CG12045-PA 1..123 20..146 149 31.1 Plus
Lcp9-PA 92 CG16914-PA 1..85 21..110 147 36.7 Plus
Lcp1-PB 130 CG11650-PB 33..121 41..138 147 30.6 Plus
Lcp1-PA 130 CG11650-PA 33..121 41..138 147 30.6 Plus
Cpr78Cb-PB 140 CG7663-PB 47..128 65..137 142 40.2 Plus
Cpr78Cb-PA 140 CG7663-PA 47..128 65..137 142 40.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19059-PA 126 GI19059-PA 1..125 21..146 384 58.7 Plus
Dmoj\GI13312-PA 120 GI13312-PA 1..117 20..145 215 39.5 Plus
Dmoj\GI19544-PA 132 GI19544-PA 3..120 22..145 212 43.3 Plus
Dmoj\GI12010-PA 117 GI12010-PA 6..115 24..138 198 38.7 Plus
Dmoj\GI12994-PA 134 GI12994-PA 1..121 20..145 188 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11635-PA 126 GL11635-PA 13..126 33..146 425 78.9 Plus
Dper\GL11748-PA 122 GL11748-PA 1..115 20..139 210 39 Plus
Dper\GL24590-PA 121 GL24590-PA 1..113 20..138 207 39.3 Plus
Dper\GL15560-PA 102 GL15560-PA 1..100 21..118 198 41.6 Plus
Dper\GL25976-PA 192 GL25976-PA 13..122 20..140 189 37.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21128-PA 126 GA21128-PA 1..126 21..146 460 76.2 Plus
Dpse\GA14899-PA 122 GA14899-PA 1..115 20..139 210 39 Plus
Dpse\GA20516-PA 121 GA20516-PA 3..113 22..138 206 40.8 Plus
Dpse\GA20238-PA 102 GA20238-PA 1..100 21..118 195 41.6 Plus
Dpse\Pcp-PA 250 GA17453-PA 71..180 20..140 187 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21381-PA 126 GM21381-PA 1..125 21..145 637 97.6 Plus
Dsec\GM22150-PA 122 GM22150-PA 1..120 20..146 214 39.2 Plus
Dsec\GM25234-PA 122 GM25234-PA 1..122 20..146 205 36.8 Plus
Dsec\GM13865-PA 101 GM13865-PA 1..99 21..121 187 43.1 Plus
Dsec\GM14760-PA 109 GM14760-PA 29..106 43..121 174 46.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10878-PA 126 GD10878-PA 1..125 21..145 637 97.6 Plus
Dsim\GD12126-PA 122 GD12126-PA 1..120 20..146 214 39.2 Plus
Dsim\GD14266-PA 116 GD14266-PA 1..116 20..137 198 34.7 Plus
Dsim\GD17593-PA 127 GD17593-PA 3..116 22..144 190 37.1 Plus
Dsim\GD14953-PA 101 GD14953-PA 1..99 21..121 189 46.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20028-PA 126 GJ20028-PA 1..125 21..145 438 67.2 Plus
Dvir\GJ13137-PA 139 GJ13137-PA 1..123 20..146 243 38.2 Plus
Dvir\GJ13281-PA 119 GJ13281-PA 6..115 24..138 231 43.7 Plus
Dvir\GJ12082-PA 120 GJ12082-PA 1..117 20..145 222 41.1 Plus
Dvir\GJ21116-PA 156 GJ21116-PA 22..137 20..140 213 40.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22932-PA 134 GK22932-PA 29..133 41..145 453 80 Plus
Dwil\GK20425-PA 121 GK20425-PA 1..119 20..145 212 40.3 Plus
Dwil\GK16649-PA 134 GK16649-PA 38..130 46..146 208 42.6 Plus
Dwil\GK20466-PA 121 GK20466-PA 1..119 20..140 201 39.1 Plus
Dwil\GK17269-PA 108 GK17269-PA 1..105 21..121 189 44.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12454-PA 126 GE12454-PA 1..126 21..146 628 95.2 Plus
Dyak\GE22345-PA 121 GE22345-PA 1..120 20..146 211 39.2 Plus
Dyak\GE22714-PA 120 GE22714-PA 1..119 21..146 207 38.8 Plus
Dyak\GE21770-PA 122 GE21770-PA 1..122 20..146 206 36.1 Plus
Dyak\GE21769-PA 134 GE21769-PA 33..117 46..138 191 40.9 Plus

MIP29918.hyp Sequence

Translation from 0 to 440

> MIP29918.hyp
RHQLGLHCSDIDIERNRDPVMKYLMLIALFVVAASATDNDDPISQESNVE
YNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYV
VSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHPYKTPEQKQ*

MIP29918.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Af-PB 126 CG8510-PB 1..126 21..146 666 100 Plus
Cpr49Af-PA 126 CG8510-PA 1..126 21..146 666 100 Plus
Cpr49Aa-PB 144 CG30045-PB 34..135 43..144 224 41.2 Plus
Edg78E-PB 122 CG7673-PB 3..120 22..146 219 39.8 Plus
Edg78E-PA 122 CG7673-PA 3..120 22..146 219 39.8 Plus