Clone MIP29924 Report

Search the DGRC for MIP29924

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:299
Well:24
Vector:pOT2
Associated Gene/TranscriptCG42834-RA
Protein status:MIP29924.pep: gold
Sequenced Size:553

Clone Sequence Records

MIP29924.complete Sequence

553 bp assembled on 2011-03-30

GenBank Submission: BT126236.1

> MIP29924.complete
CAATACTCACAAAGCTGAATATCAAAATGGCTCTTCGTATTATTTTTGTC
TTCATTGCCACAATCGTCCTGGCGCAAGGATCAAATATTTCGCCAGTTGC
GCAGGAGAATCTTGTGCGGGTCCATCACTCTGGAGTGGTTTCATCTGGAG
CTCCTGCCGTTGGTGTTACCCAGAGCCGCTCAGTTGTTTCGCAAGCTCAG
CGTCCTAACTATGGTCAGAGATCCATCTCTGGATCTATCGGAGGATCTCG
TCGAGTGGGCGAAGTTCCAGTGTCCGGATCTCGTCCTCATGGTGGTGCTC
CTCGTCGTTCTTCTGCAAGCGCTTATGCTCGTCCCATCGGAGGTGGAGCT
ACCCCAGGATATGTCCACCGCAACCGCAACCAGAAACCATATTAGAAACA
CCTTAAAAATTATACACCATCCCATCCCGATCTGACGAAATGTTCTAAGC
CCTATTATCATTTAAATGATCTTATCACAGCTCTTTTATAACATAATTTC
TAATAGCCATACTCTGGAAATAAAAATTTGATAAACAAAAAAAAAAAAAA
AAA

MIP29924.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13243116..13243651 1..536 2665 99.8 Plus
chr3R 27901430 chr3R 13246200..13246334 354..220 240 78.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17418759..17419298 1..540 2700 100 Plus
3R 32079331 3R 17421849..17421983 354..220 225 77.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17159590..17160129 1..540 2700 100 Plus
3R 31820162 3R 17162680..17162814 354..220 225 77.7 Minus
Blast to na_te.dros performed 2019-03-16 22:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 4552..4592 49..7 111 76.7 Minus

MIP29924.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:54:13 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13243116..13243651 1..536 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:18 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 1..369 27..395 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:06 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 1..369 27..395 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:32:22 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 1..369 27..395 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:18 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 1..369 27..395 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:06 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 1..536 1..536 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:22 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 1..536 1..536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:13 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17418759..17419294 1..536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:13 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17418759..17419294 1..536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:13 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17418759..17419294 1..536 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:06 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13244481..13245016 1..536 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:03:52 Download gff for MIP29924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17159590..17160125 1..536 100   Plus

MIP29924.pep Sequence

Translation from 2 to 394

> MIP29924.pep
ILTKLNIKMALRIIFVFIATIVLAQGSNISPVAQENLVRVHHSGVVSSGA
PAVGVTQSRSVVSQAQRPNYGQRSISGSIGGSRRVGEVPVSGSRPHGGAP
RRSSASAYARPIGGGATPGYVHRNRNQKPY*

MIP29924.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16774-PA 124 GG16774-PA 1..124 9..130 233 52 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42834-PA 122 CG42834-PA 1..122 9..130 616 100 Plus
CG14332-PA 124 CG14332-PA 1..124 9..130 304 54.8 Plus
CG33333-PA 148 CG33333-PA 1..88 9..111 139 39.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15234-PA 122 GM15234-PA 1..122 9..130 464 86.1 Plus
Dsec\GM15364-PA 124 GM15364-PA 1..124 9..130 280 54.8 Plus
Dsec\GM15235-PA 148 GM15235-PA 1..76 9..85 153 51.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19159-PA 122 GD19159-PA 1..122 9..130 454 86.1 Plus
Dsim\GD20233-PA 123 GD20233-PA 1..123 9..130 282 58.1 Plus
Dsim\GD19160-PA 148 GD19160-PA 1..76 9..85 148 50.6 Plus
Dsim\GD19158-PA 148 GD19158-PA 1..95 9..111 142 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10133-PA 142 GE10133-PA 1..142 9..130 355 64.8 Plus
Dyak\GE25271-PA 124 GE25271-PA 1..124 9..130 234 56.5 Plus
Dyak\GE10134-PA 150 GE10134-PA 1..76 9..85 136 48.1 Plus
Dyak\GE10132-PA 139 GE10132-PA 1..96 9..110 134 39.4 Plus

MIP29924.hyp Sequence

Translation from 2 to 394

> MIP29924.hyp
ILTKLNIKMALRIIFVFIATIVLAQGSNISPVAQENLVRVHHSGVVSSGA
PAVGVTQSRSVVSQAQRPNYGQRSISGSIGGSRRVGEVPVSGSRPHGGAP
RRSSASAYARPIGGGATPGYVHRNRNQKPY*

MIP29924.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42834-PA 122 CG42834-PA 1..122 9..130 616 100 Plus
CG14332-PA 124 CG14332-PA 1..124 9..130 304 54.8 Plus
CG33333-PA 148 CG33333-PA 1..88 9..111 139 39.8 Plus