Clone Sequence Records
MIP29924.complete Sequence
553 bp assembled on 2011-03-30
GenBank Submission: BT126236.1
> MIP29924.complete
CAATACTCACAAAGCTGAATATCAAAATGGCTCTTCGTATTATTTTTGTC
TTCATTGCCACAATCGTCCTGGCGCAAGGATCAAATATTTCGCCAGTTGC
GCAGGAGAATCTTGTGCGGGTCCATCACTCTGGAGTGGTTTCATCTGGAG
CTCCTGCCGTTGGTGTTACCCAGAGCCGCTCAGTTGTTTCGCAAGCTCAG
CGTCCTAACTATGGTCAGAGATCCATCTCTGGATCTATCGGAGGATCTCG
TCGAGTGGGCGAAGTTCCAGTGTCCGGATCTCGTCCTCATGGTGGTGCTC
CTCGTCGTTCTTCTGCAAGCGCTTATGCTCGTCCCATCGGAGGTGGAGCT
ACCCCAGGATATGTCCACCGCAACCGCAACCAGAAACCATATTAGAAACA
CCTTAAAAATTATACACCATCCCATCCCGATCTGACGAAATGTTCTAAGC
CCTATTATCATTTAAATGATCTTATCACAGCTCTTTTATAACATAATTTC
TAATAGCCATACTCTGGAAATAAAAATTTGATAAACAAAAAAAAAAAAAA
AAA
MIP29924.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:53:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 13243116..13243651 | 1..536 | 2665 | 99.8 | Plus |
chr3R | 27901430 | chr3R | 13246200..13246334 | 354..220 | 240 | 78.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:53:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17418759..17419298 | 1..540 | 2700 | 100 | Plus |
3R | 32079331 | 3R | 17421849..17421983 | 354..220 | 225 | 77.8 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 17159590..17160129 | 1..540 | 2700 | 100 | Plus |
3R | 31820162 | 3R | 17162680..17162814 | 354..220 | 225 | 77.7 | Minus |
Blast to na_te.dros performed 2019-03-16 22:53:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy4 | 6852 | gypsy4 GYPSY4 6852bp | 4552..4592 | 49..7 | 111 | 76.7 | Minus |
MIP29924.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:54:13 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 13243116..13243651 | 1..536 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:18 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42834-RA | 1..369 | 27..395 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:06 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42834-RA | 1..369 | 27..395 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:32:22 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42834-RA | 1..369 | 27..395 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:18 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42834-RA | 1..369 | 27..395 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:06 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42834-RA | 1..536 | 1..536 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:22 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42834-RA | 1..536 | 1..536 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:13 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17418759..17419294 | 1..536 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:13 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17418759..17419294 | 1..536 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:13 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17418759..17419294 | 1..536 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:06 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13244481..13245016 | 1..536 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:03:52 Download gff for
MIP29924.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17159590..17160125 | 1..536 | 100 | | Plus |
MIP29924.pep Sequence
Translation from 2 to 394
> MIP29924.pep
ILTKLNIKMALRIIFVFIATIVLAQGSNISPVAQENLVRVHHSGVVSSGA
PAVGVTQSRSVVSQAQRPNYGQRSISGSIGGSRRVGEVPVSGSRPHGGAP
RRSSASAYARPIGGGATPGYVHRNRNQKPY*
MIP29924.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:37:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16774-PA | 124 | GG16774-PA | 1..124 | 9..130 | 233 | 52 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42834-PA | 122 | CG42834-PA | 1..122 | 9..130 | 616 | 100 | Plus |
CG14332-PA | 124 | CG14332-PA | 1..124 | 9..130 | 304 | 54.8 | Plus |
CG33333-PA | 148 | CG33333-PA | 1..88 | 9..111 | 139 | 39.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:37:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15234-PA | 122 | GM15234-PA | 1..122 | 9..130 | 464 | 86.1 | Plus |
Dsec\GM15364-PA | 124 | GM15364-PA | 1..124 | 9..130 | 280 | 54.8 | Plus |
Dsec\GM15235-PA | 148 | GM15235-PA | 1..76 | 9..85 | 153 | 51.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:37:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19159-PA | 122 | GD19159-PA | 1..122 | 9..130 | 454 | 86.1 | Plus |
Dsim\GD20233-PA | 123 | GD20233-PA | 1..123 | 9..130 | 282 | 58.1 | Plus |
Dsim\GD19160-PA | 148 | GD19160-PA | 1..76 | 9..85 | 148 | 50.6 | Plus |
Dsim\GD19158-PA | 148 | GD19158-PA | 1..95 | 9..111 | 142 | 41.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:37:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10133-PA | 142 | GE10133-PA | 1..142 | 9..130 | 355 | 64.8 | Plus |
Dyak\GE25271-PA | 124 | GE25271-PA | 1..124 | 9..130 | 234 | 56.5 | Plus |
Dyak\GE10134-PA | 150 | GE10134-PA | 1..76 | 9..85 | 136 | 48.1 | Plus |
Dyak\GE10132-PA | 139 | GE10132-PA | 1..96 | 9..110 | 134 | 39.4 | Plus |
MIP29924.hyp Sequence
Translation from 2 to 394
> MIP29924.hyp
ILTKLNIKMALRIIFVFIATIVLAQGSNISPVAQENLVRVHHSGVVSSGA
PAVGVTQSRSVVSQAQRPNYGQRSISGSIGGSRRVGEVPVSGSRPHGGAP
RRSSASAYARPIGGGATPGYVHRNRNQKPY*
MIP29924.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42834-PA | 122 | CG42834-PA | 1..122 | 9..130 | 616 | 100 | Plus |
CG14332-PA | 124 | CG14332-PA | 1..124 | 9..130 | 304 | 54.8 | Plus |
CG33333-PA | 148 | CG33333-PA | 1..88 | 9..111 | 139 | 39.8 | Plus |