Clone MIP30002 Report

Search the DGRC for MIP30002

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:300
Well:2
Vector:pOT2
Associated Gene/TranscriptCpr30F-RA
Protein status:MIP30002.pep: gold
Sequenced Size:841

Clone Sequence Records

MIP30002.complete Sequence

841 bp assembled on 2011-04-04

GenBank Submission: BT126206.1

> MIP30002.complete
AGGAGCCGCAGCAGCAGCCATCAAGTCAACAAATCCACCAAATCCAAGTC
CAAACCAAAATGTTCGCTCTCGTATCGCTTTTCATCCTGGGTGTTGGTGC
CGCCGCCGCCATCGAGCTGCCCATCTACCACTCACCCGCGGCCATTGTGA
AGCCACTGCTGAAGACCGTAGAGGTGGAGGCACCTGCCCACTACGATTTC
GCCTACTCGGTGCACGACGAGCACACCGGCGACATCAAGAGCCAGACGGA
GTCGCGGAAGGGCGATCAGGTCCAGGGTCAGTACACGCTGGTCGATGCCG
ATGGCTATCTGCGCACCGTGGACTACACTTCGGATGCCCACAACGGCTTC
AATGCGGTGGTGCGTCGCGATCCCCTGGGCCAGAAGGTGATCAAGGCTGC
GCCCATTGCCAAGCTCCTGGCTCCCGCACCACTGCCACTGGCCTATGCGG
CACCCAAGCTCCTCGCGCCCGCTAAACTGCCCCTCGGCCTTTACCATTAG
GTTCTGGGTAGGATTGATCGAGAGAGATAGCAAACACTGACTTCATCGCA
TCGACGACGACCCATCCGCATCCGCATCCGCATCTGTATCTGTATCTGAA
CTATTACTATTACTACCCAAACACCTCGTATCATATCCAGCTTGCTCTGA
TCTTTCTTCCTATCTTCTGATCCTATTCTCTGATATCTCTACTAAGACTA
CTTCGGCTCCAGGTCATCAAAATCGCCATAAACCGATGACTGGGGGTCTC
TATCTCATCTATGTAATACTATGTATGTGTAAATAGAAGGCAATAAATGC
ATGTTTAGAAAACACAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP30002.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9931186..9931932 815..69 3735 100 Minus
chr2L 23010047 chr2L 9931998..9932065 68..1 340 100 Minus
chr2L 23010047 chr2L 9541981..9542109 222..350 240 79.1 Plus
chr3L 24539361 chr3L 4210455..4210593 363..225 230 77.7 Minus
chr3R 27901430 chr3R 2513002..2513110 270..378 215 79.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9932270..9933018 817..69 3745 100 Minus
2L 23513712 2L 9933084..9933151 68..1 340 100 Minus
2L 23513712 2L 9543143..9543271 222..350 240 79.1 Plus
3L 28110227 3L 4211069..4211207 363..225 230 77.7 Minus
3R 32079331 3R 6687190..6687298 270..378 215 79.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9932270..9933018 817..69 3745 100 Minus
2L 23513712 2L 9933084..9933151 68..1 340 100 Minus
2L 23513712 2L 9543143..9543271 222..350 240 79 Plus
3L 28103327 3L 4211069..4211207 363..225 230 77.6 Minus
3R 31820162 3R 6428021..6428129 270..378 215 79.8 Plus
Blast to na_te.dros performed on 2019-03-16 22:55:09 has no hits.

MIP30002.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:55:54 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9931186..9931932 69..815 100 <- Minus
chr2L 9931998..9932065 1..68 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:31 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30F-RA 1..441 60..500 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:59 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30F-RA 1..441 60..500 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:33:14 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30F-RA 1..441 60..500 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:31 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30F-RA 1..441 60..500 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:59 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30F-RA 1..815 1..815 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:33:14 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr30F-RA 13..827 1..815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:54 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9932272..9933018 69..815 100 <- Minus
2L 9933084..9933151 1..68 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:54 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9932272..9933018 69..815 100 <- Minus
2L 9933084..9933151 1..68 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:54 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9932272..9933018 69..815 100 <- Minus
2L 9933084..9933151 1..68 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:59 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9932272..9933018 69..815 100 <- Minus
arm_2L 9933084..9933151 1..68 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:21 Download gff for MIP30002.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9932272..9933018 69..815 100 <- Minus
2L 9933084..9933151 1..68 100   Minus

MIP30002.hyp Sequence

Translation from 2 to 499

> MIP30002.hyp
EPQQQPSSQQIHQIQVQTKMFALVSLFILGVGAAAAIELPIYHSPAAIVK
PLLKTVEVEAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDAD
GYLRTVDYTSDAHNGFNAVVRRDPLGQKVIKAAPIAKLLAPAPLPLAYAA
PKLLAPAKLPLGLYH*

MIP30002.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr30F-PA 146 CG31876-PA 1..146 20..165 746 100 Plus
Cpr31A-PA 340 CG33302-PA 103..233 31..165 289 45.2 Plus
Cpr64Aa-PA 192 CG15006-PA 11..158 22..157 264 46.7 Plus
Ccp84Ad-PA 199 CG2341-PA 3..162 21..156 258 42.6 Plus
Cpr30B-PA 153 CG3818-PA 30..141 61..164 256 50 Plus

MIP30002.pep Sequence

Translation from 2 to 499

> MIP30002.pep
EPQQQPSSQQIHQIQVQTKMFALVSLFILGVGAAAAIELPIYHSPAAIVK
PLLKTVEVEAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDAD
GYLRTVDYTSDAHNGFNAVVRRDPLGQKVIKAAPIAKLLAPAPLPLAYAA
PKLLAPAKLPLGLYH*

MIP30002.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14150-PA 146 GF14150-PA 1..125 20..141 611 95.2 Plus
Dana\GF22765-PA 153 GF22765-PA 4..141 19..164 263 44.3 Plus
Dana\GF17800-PA 223 GF17800-PA 4..147 19..145 254 44.1 Plus
Dana\GF15740-PA 356 GF15740-PA 125..204 44..123 248 57.5 Plus
Dana\GF17184-PA 186 GF17184-PA 32..131 59..149 243 52 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23995-PA 146 GG23995-PA 1..146 20..165 733 97.9 Plus
Dere\GG25358-PA 155 GG25358-PA 31..143 60..164 254 49.6 Plus
Dere\GG10082-PA 338 GG10082-PA 123..194 52..123 242 61.1 Plus
Dere\GG14206-PA 148 GG14206-PA 28..146 20..146 231 45 Plus
Dere\GG13610-PA 183 GG13610-PA 37..130 64..149 230 54.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10434-PA 139 GH10434-PA 1..139 20..165 514 76.4 Plus
Dgri\GH10431-PA 150 GH10431-PA 28..132 60..157 297 60 Plus
Dgri\GH11071-PA 352 GH11071-PA 103..180 46..123 240 57.7 Plus
Dgri\GH15052-PA 136 GH15052-PA 10..132 20..144 232 45 Plus
Dgri\GH19489-PA 147 GH19489-PA 47..143 50..148 230 51.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr30F-PA 146 CG31876-PA 1..146 20..165 746 100 Plus
Cpr31A-PA 340 CG33302-PA 103..233 31..165 289 45.2 Plus
Cpr64Aa-PA 192 CG15006-PA 11..158 22..157 264 46.7 Plus
Ccp84Ad-PA 199 CG2341-PA 3..162 21..156 258 42.6 Plus
Cpr30B-PA 153 CG3818-PA 30..141 61..164 256 50 Plus
Ccp84Ag-PA 191 CG2342-PA 3..156 21..159 253 40.7 Plus
Ccp84Ab-PA 221 CG1252-PA 6..162 20..156 253 41.1 Plus
Ccp84Ae-PA 208 CG1330-PA 4..145 19..151 251 40.6 Plus
Edg84A-PA 188 CG2345-PA 1..130 20..161 248 43.7 Plus
Ccp84Aa-PA 205 CG2360-PA 6..162 20..156 247 40.5 Plus
Cpr5C-PA 145 CG4052-PA 3..141 21..140 246 44.3 Plus
Ccp84Af-PA 151 CG1331-PA 4..147 19..148 246 44 Plus
Cpr92A-PA 245 CG6240-PA 68..158 64..160 245 51.5 Plus
CG34461-PB 138 CG34461-PB 2..134 19..144 244 46 Plus
CG34461-PA 138 CG34461-PA 2..134 19..144 244 46 Plus
Ccp84Ac-PA 217 CG1327-PA 65..171 64..157 242 52.3 Plus
Cpr64Ab-PA 120 CG15007-PA 2..118 22..146 229 45.6 Plus
Cpr66Cb-PA 162 CG7076-PA 81..147 56..122 227 62.7 Plus
CG42367-PC 103 CG42367-PC 33..102 58..127 221 55.7 Plus
Cpr64Ad-PB 247 CG1259-PB 116..244 34..156 218 42.7 Plus
Cpr62Bc-PB 180 CG1919-PB 46..146 56..165 217 45.5 Plus
Cpr62Bc-PA 180 CG1919-PA 46..146 56..165 217 45.5 Plus
Cpr23B-PA 302 CG2973-PA 150..235 57..143 214 50.6 Plus
Cpr35B-PA 218 CG3474-PA 67..133 59..125 202 56.7 Plus
Cpr62Bb-PC 194 CG13935-PC 35..150 64..157 194 44.8 Plus
Cpr62Bb-PB 194 CG13935-PB 35..150 64..157 194 44.8 Plus
Cpr62Bb-PA 194 CG13935-PA 35..150 64..157 194 44.8 Plus
Cpr76Bb-PA 198 CG9290-PA 86..144 64..122 192 59.3 Plus
Cpr76Bc-PD 424 CG9295-PD 33..113 44..121 190 48.8 Plus
Cpr76Bc-PC 424 CG9295-PC 33..113 44..121 190 48.8 Plus
Cpr76Ba-PA 204 CG9283-PA 92..157 59..121 185 54.5 Plus
Cpr64Ac-PA 188 CG15008-PA 64..188 41..165 183 37.7 Plus
Crys-PB 477 CG16963-PB 77..141 64..128 171 50.8 Plus
Crys-PA 477 CG16963-PA 77..141 64..128 171 50.8 Plus
CG13670-PA 266 CG13670-PA 42..159 9..120 165 34.7 Plus
Cpr76Bd-PD 1228 CG9299-PD 1129..1209 40..120 163 43.2 Plus
Cpr76Bd-PB 1228 CG9299-PB 1129..1209 40..120 163 43.2 Plus
Cpr76Bd-PC 1231 CG9299-PC 1132..1212 40..120 163 43.2 Plus
Cpr66D-PA 270 CG32029-PA 158..218 64..124 142 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24313-PA 146 GI24313-PA 1..146 20..165 601 81.1 Plus
Dmoj\GI24282-PA 151 GI24282-PA 31..126 60..152 279 58.8 Plus
Dmoj\GI23842-PA 176 GI23842-PA 3..155 21..157 247 43.5 Plus
Dmoj\GI23757-PA 176 GI23757-PA 3..155 21..157 245 43.5 Plus
Dmoj\GI23759-PA 145 GI23759-PA 47..143 50..148 243 54.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19198-PA 146 GL19198-PA 1..145 20..164 644 88.5 Plus
Dper\GL18957-PA 316 GL18957-PA 106..193 52..141 257 55.6 Plus
Dper\GL18914-PA 149 GL18914-PA 30..137 60..164 247 50.5 Plus
Dper\GL24692-PA 133 GL24692-PA 49..129 64..144 235 59 Plus
Dper\GL24694-PA 159 GL24694-PA 78..144 56..122 222 62.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16543-PA 146 GA16543-PA 1..145 20..164 644 88.5 Plus
Dpse\GA25870-PA 316 GA25870-PA 106..193 52..141 258 55.6 Plus
Dpse\GA25856-PA 149 GA25856-PA 30..137 60..164 247 50.5 Plus
Dpse\GA23954-PA 133 GA23954-PA 49..129 64..144 235 59 Plus
Dpse\GA20083-PA 159 GA20083-PA 78..144 56..122 222 62.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12125-PA 146 GM12125-PA 1..146 20..165 748 100 Plus
Dsec\GM17521-PA 153 GM17521-PA 29..141 60..164 253 49.6 Plus
Dsec\GM10909-PA 188 GM10909-PA 37..114 64..141 243 59 Plus
Dsec\GM17905-PA 339 GM17905-PA 123..194 52..123 239 59.7 Plus
Dsec\GM10533-PA 217 GM10533-PA 65..139 64..135 231 61.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22323-PA 146 GD22323-PA 1..146 20..165 748 100 Plus
Dsim\GD23612-PA 153 GD23612-PA 29..141 60..164 253 49.6 Plus
Dsim\GD19888-PA 188 GD19888-PA 36..131 63..162 242 54 Plus
Dsim\GD23654-PA 341 GD23654-PA 123..194 52..123 238 59.7 Plus
Dsim\GD19528-PA 217 GD19528-PA 65..139 64..135 231 61.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21574-PA 146 GJ21574-PA 1..146 20..165 616 81.8 Plus
Dvir\GJ21540-PA 153 GJ21540-PA 31..130 60..154 285 58.4 Plus
Dvir\GJ17932-PA 343 GJ17932-PA 106..185 46..125 262 61.3 Plus
Dvir\GJ23301-PA 175 GJ23301-PA 66..145 64..144 238 59.3 Plus
Dvir\GJ23298-PA 181 GJ23298-PA 40..137 64..154 238 52.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24776-PA 148 GK24776-PA 1..148 20..165 604 88.7 Plus
Dwil\GK12249-PA 228 GK12249-PA 55..149 64..153 244 54.7 Plus
Dwil\GK12723-PA 352 GK12723-PA 132..207 48..123 244 56.6 Plus
Dwil\GK10832-PA 179 GK10832-PA 55..149 64..153 243 54.7 Plus
Dwil\GK24775-PA 155 GK24775-PA 29..143 59..164 242 47 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10171-PA 146 GE10171-PA 1..146 20..165 737 97.9 Plus
Dyak\GE18851-PA 155 GE18851-PA 31..143 60..164 250 48.7 Plus
Dyak\GE18895-PA 345 GE18895-PA 123..194 52..123 240 61.1 Plus
Dyak\GE24878-PA 188 GE24878-PA 1..114 20..141 235 45.1 Plus
Dyak\GE20635-PA 120 GE20635-PA 1..118 21..146 230 45.3 Plus