Clone MIP30065 Report

Search the DGRC for MIP30065

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:300
Well:65
Vector:pOT2
Associated Gene/TranscriptCG42779-RA
Protein status:MIP30065.pep: gold
Sequenced Size:274

Clone Sequence Records

MIP30065.complete Sequence

274 bp assembled on 2011-03-30

GenBank Submission: BT126198.1

> MIP30065.complete
ATTTAAAGTTAGCAACATGAAGTTTTTTGCCATCCTCCTCCTTTTGTGCA
CCATGGTAGCTGTTGCAATTGCCGCAACAACCACAACCACAACGGAGAAC
ATTGATTGGGGTTCTGCAAGTACAACTGAAATACCGGCAACAACTACAGC
AACTCCATGTGAATCAGCTGACGCCAAGAAATTATATTTCTTTTATAAAT
AATATGGCTTCAAAATATTCATATTTTTGAGTAAAATAAAAATATAGAAC
AATCCCAAAAAAAAAAAAAAAAAA

MIP30065.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12946015..12946279 1..256 1125 95.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17121577..17121837 1..261 1275 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16862408..16862668 1..261 1275 99.2 Plus
Blast to na_te.dros performed on 2019-03-16 22:54:18 has no hits.

MIP30065.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:55:28 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12946015..12946279 1..256 96   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:21 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RA 1..186 17..202 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:15 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RA 1..186 17..202 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:32:31 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RB 1..186 17..202 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:21 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RA 1..186 17..202 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:15 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RA 1..256 1..256 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:31 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RB 1..256 1..256 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:28 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17121577..17121832 1..256 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:28 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17121577..17121832 1..256 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:28 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17121577..17121832 1..256 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:15 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12947299..12947554 1..256 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:03:56 Download gff for MIP30065.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16862408..16862663 1..256 99   Plus

MIP30065.hyp Sequence

Translation from 0 to 201

> MIP30065.hyp
FKVSNMKFFAILLLLCTMVAVAIAATTTTTTENIDWGSASTTEIPATTTA
TPCESADAKKLYFFYK*

MIP30065.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG42779-PA 61 CG42779-PA 1..61 6..66 311 100 Plus
CG42779-PB 61 CG42779-PB 1..61 6..66 311 100 Plus

MIP30065.pep Sequence

Translation from 1 to 201

> MIP30065.pep
FKVSNMKFFAILLLLCTMVAVAIAATTTTTTENIDWGSASTTEIPATTTA
TPCESADAKKLYFFYK*

MIP30065.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG42779-PA 61 CG42779-PA 1..61 6..66 311 100 Plus
CG42779-PB 61 CG42779-PB 1..61 6..66 311 100 Plus