MIP30065.complete Sequence
274 bp assembled on 2011-03-30
GenBank Submission: BT126198.1
> MIP30065.complete
ATTTAAAGTTAGCAACATGAAGTTTTTTGCCATCCTCCTCCTTTTGTGCA
CCATGGTAGCTGTTGCAATTGCCGCAACAACCACAACCACAACGGAGAAC
ATTGATTGGGGTTCTGCAAGTACAACTGAAATACCGGCAACAACTACAGC
AACTCCATGTGAATCAGCTGACGCCAAGAAATTATATTTCTTTTATAAAT
AATATGGCTTCAAAATATTCATATTTTTGAGTAAAATAAAAATATAGAAC
AATCCCAAAAAAAAAAAAAAAAAA
MIP30065.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:54:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 12946015..12946279 | 1..256 | 1125 | 95.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17121577..17121837 | 1..261 | 1275 | 99.2 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 16862408..16862668 | 1..261 | 1275 | 99.2 | Plus |
Blast to na_te.dros performed on 2019-03-16 22:54:18 has no hits.
MIP30065.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:55:28 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 12946015..12946279 | 1..256 | 96 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:21 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RA | 1..186 | 17..202 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:15 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RA | 1..186 | 17..202 | 98 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:32:31 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RB | 1..186 | 17..202 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:21 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RA | 1..186 | 17..202 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:15 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RA | 1..256 | 1..256 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:31 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RB | 1..256 | 1..256 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:28 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17121577..17121832 | 1..256 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:28 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17121577..17121832 | 1..256 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:28 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17121577..17121832 | 1..256 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:15 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 12947299..12947554 | 1..256 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:03:56 Download gff for
MIP30065.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 16862408..16862663 | 1..256 | 99 | | Plus |
MIP30065.hyp Sequence
Translation from 0 to 201
> MIP30065.hyp
FKVSNMKFFAILLLLCTMVAVAIAATTTTTTENIDWGSASTTEIPATTTA
TPCESADAKKLYFFYK*
MIP30065.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42779-PA | 61 | CG42779-PA | 1..61 | 6..66 | 311 | 100 | Plus |
CG42779-PB | 61 | CG42779-PB | 1..61 | 6..66 | 311 | 100 | Plus |
MIP30065.pep Sequence
Translation from 1 to 201
> MIP30065.pep
FKVSNMKFFAILLLLCTMVAVAIAATTTTTTENIDWGSASTTEIPATTTA
TPCESADAKKLYFFYK*
MIP30065.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42779-PA | 61 | CG42779-PA | 1..61 | 6..66 | 311 | 100 | Plus |
CG42779-PB | 61 | CG42779-PB | 1..61 | 6..66 | 311 | 100 | Plus |