BDGP Sequence Production Resources |
Search the DGRC for MIP30120
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 301 |
Well: | 20 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13445-RA |
Protein status: | MIP30120.pep: gold |
Sequenced Size: | 452 |
452 bp assembled on 2011-03-30
GenBank Submission: BT126201.1
> MIP30120.complete TCAATCATCAAATATGCAGTCTAACAAGGTTTTCTTCGTGTTCTTTGGTA TCATCGCCATGGTGATCGCCGCCAGTCTCTCCTCGGATGTTGTGGACAAG GGTGATGATGTGATCAGCGATCGTCGTTTCCGTTGGGAATTCTCGCAGGA CTCGGATGAGTCTGCCAACGACTTGCAGGAGGATGATGATGATGATGACG ATGCCGCGGATGATGACAGCGGCAGTGCATCCGAAGAAATTTTGATCATC GAGTATCCTGAAGGCTACGAAAGCGGCTCCAATGAAAGCGCCTCCGATGA AAGCGTCTCCGATGAAAGCGCCTCCAATGAATCTTAATCATTTAGTTAAC AGTTTTTGTAATTTTTGTTTTTATAAATAGTATTTGTTGTTATGGCGAAA AGTTTTAAAATTATACGATATTTGTGAGCGTAAAAAAAAAAAAAAAAAAA AA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15799309..15799355 | 1..47 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13445-RA | 1..324 | 14..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13445-RA | 1..324 | 14..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13445-RA | 1..324 | 14..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13445-RA | 1..324 | 14..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13445-RA | 1..431 | 1..431 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13445-RA | 1..431 | 1..431 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15809594..15809977 | 48..431 | 100 | Plus | |
3L | 15809485..15809531 | 1..47 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15809594..15809977 | 48..431 | 100 | Plus | |
3L | 15809485..15809531 | 1..47 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15809594..15809977 | 48..431 | 100 | Plus | |
3L | 15809485..15809531 | 1..47 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15802585..15802631 | 1..47 | 100 | -> | Plus |
arm_3L | 15802694..15803077 | 48..431 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15802694..15803077 | 48..431 | 100 | Plus | |
3L | 15802585..15802631 | 1..47 | 100 | -> | Plus |
Translation from 0 to 336
> MIP30120.hyp QSSNMQSNKVFFVFFGIIAMVIAASLSSDVVDKGDDVISDRRFRWEFSQD SDESANDLQEDDDDDDDAADDDSGSASEEILIIEYPEGYESGSNESASDE SVSDESASNES*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13445-PA | 107 | CG13445-PA | 1..107 | 5..111 | 536 | 100 | Plus |
Translation from 1 to 336
> MIP30120.pep QSSNMQSNKVFFVFFGIIAMVIAASLSSDVVDKGDDVISDRRFRWEFSQD SDESANDLQEDDDDDDDAADDDSGSASEEILIIEYPEGYESGSNESASDE SVSDESASNES*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24094-PA | 116 | GF24094-PA | 1..55 | 5..59 | 143 | 57.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15928-PA | 112 | GG15928-PA | 1..112 | 5..106 | 332 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13445-PA | 107 | CG13445-PA | 1..107 | 5..111 | 536 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25210-PA | 112 | GL25210-PA | 1..41 | 5..45 | 152 | 63.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23729-PA | 112 | GA23729-PA | 1..53 | 5..57 | 157 | 54.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25558-PA | 105 | GM25558-PA | 1..105 | 5..111 | 486 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14573-PA | 107 | GD14573-PA | 1..107 | 5..111 | 409 | 93.5 | Plus |