Clone MIP30120 Report

Search the DGRC for MIP30120

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:301
Well:20
Vector:pOT2
Associated Gene/TranscriptCG13445-RA
Protein status:MIP30120.pep: gold
Sequenced Size:452

Clone Sequence Records

MIP30120.complete Sequence

452 bp assembled on 2011-03-30

GenBank Submission: BT126201.1

> MIP30120.complete
TCAATCATCAAATATGCAGTCTAACAAGGTTTTCTTCGTGTTCTTTGGTA
TCATCGCCATGGTGATCGCCGCCAGTCTCTCCTCGGATGTTGTGGACAAG
GGTGATGATGTGATCAGCGATCGTCGTTTCCGTTGGGAATTCTCGCAGGA
CTCGGATGAGTCTGCCAACGACTTGCAGGAGGATGATGATGATGATGACG
ATGCCGCGGATGATGACAGCGGCAGTGCATCCGAAGAAATTTTGATCATC
GAGTATCCTGAAGGCTACGAAAGCGGCTCCAATGAAAGCGCCTCCGATGA
AAGCGTCTCCGATGAAAGCGCCTCCAATGAATCTTAATCATTTAGTTAAC
AGTTTTTGTAATTTTTGTTTTTATAAATAGTATTTGTTGTTATGGCGAAA
AGTTTTAAAATTATACGATATTTGTGAGCGTAAAAAAAAAAAAAAAAAAA
AA

MIP30120.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15799417..15799801 47..431 1925 100 Plus
chr3L 24539361 chr3L 15799309..15799357 1..49 245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15809593..15809979 47..433 1935 100 Plus
3L 28110227 3L 15809485..15809533 1..49 245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15802693..15803079 47..433 1935 100 Plus
3L 28103327 3L 15802585..15802633 1..49 245 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:54:30 has no hits.

MIP30120.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:55:33 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15799309..15799355 1..47 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:24 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 1..324 14..337 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:29 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 1..324 14..337 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:32:44 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 1..324 14..337 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:24 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 1..324 14..337 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:29 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 1..431 1..431 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:44 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
CG13445-RA 1..431 1..431 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:33 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15809594..15809977 48..431 100   Plus
3L 15809485..15809531 1..47 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:33 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15809594..15809977 48..431 100   Plus
3L 15809485..15809531 1..47 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:33 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15809594..15809977 48..431 100   Plus
3L 15809485..15809531 1..47 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:29 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15802585..15802631 1..47 100 -> Plus
arm_3L 15802694..15803077 48..431 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:01 Download gff for MIP30120.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15802694..15803077 48..431 100   Plus
3L 15802585..15802631 1..47 100 -> Plus

MIP30120.hyp Sequence

Translation from 0 to 336

> MIP30120.hyp
QSSNMQSNKVFFVFFGIIAMVIAASLSSDVVDKGDDVISDRRFRWEFSQD
SDESANDLQEDDDDDDDAADDDSGSASEEILIIEYPEGYESGSNESASDE
SVSDESASNES*

MIP30120.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13445-PA 107 CG13445-PA 1..107 5..111 536 100 Plus

MIP30120.pep Sequence

Translation from 1 to 336

> MIP30120.pep
QSSNMQSNKVFFVFFGIIAMVIAASLSSDVVDKGDDVISDRRFRWEFSQD
SDESANDLQEDDDDDDDAADDDSGSASEEILIIEYPEGYESGSNESASDE
SVSDESASNES*

MIP30120.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24094-PA 116 GF24094-PA 1..55 5..59 143 57.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15928-PA 112 GG15928-PA 1..112 5..106 332 75 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13445-PA 107 CG13445-PA 1..107 5..111 536 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25210-PA 112 GL25210-PA 1..41 5..45 152 63.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23729-PA 112 GA23729-PA 1..53 5..57 157 54.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25558-PA 105 GM25558-PA 1..105 5..111 486 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14573-PA 107 GD14573-PA 1..107 5..111 409 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22278-PA 109 GE22278-PA 1..109 5..111 320 76.1 Plus
Dyak\GE22276-PA 109 GE22276-PA 1..109 5..111 320 76.1 Plus