Clone MIP30130 Report

Search the DGRC for MIP30130

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:301
Well:30
Vector:pOT2
Associated Gene/TranscriptEig71Ek-RA
Protein status:MIP30130.pep: gold
Sequenced Size:452

Clone Sequence Records

MIP30130.complete Sequence

452 bp assembled on 2011-03-30

GenBank Submission: BT126202.1

> MIP30130.complete
GAAAACTTAAAAATGTGGAAAATATTCTTGCTGTTGGTTCTTTGTATCCT
GCAATTGTGCCACATTGATGCTCAATGGAGTCGAGTGTACTGTGAGAATA
TCTATAACGATTGTCAACGATTTACATCCAGAATAGGACGATTTGATGAG
ACTATAGATTCCTTTAATCGTCATTGTCGTCGGGAGCGCAGAGGAAGGTG
GAACAGTGTGTCTCGATGTGAAATGGAAAAAGCCACCTGTCTTCTGATTT
TTCGACGCTGTGATGATATGTCCTGTAACAACATTGCAGATGTCTTGGAA
TTGTAATCAAGTCTGGATAAAAAATGTTCTTTTGTTTAGCAACAGAAGAT
ATTAACAAAAGCTTAAGCAATAACAGTCTGGCAATAAACGCATTGTTTTA
TCAAAAGTTAATAAAGGCAAACAAAGTAATTTTAAAAAAAAAAAAAAAAA
AA

MIP30130.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15651259..15651466 37..244 1040 100 Plus
chr3L 24539361 chr3L 15651523..15651711 245..433 945 100 Plus
chr3L 24539361 chr3L 15651162..15651198 1..37 185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15661357..15661564 37..244 1040 100 Plus
3L 28110227 3L 15661621..15661811 245..435 955 100 Plus
3L 28110227 3L 15661260..15661296 1..37 185 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15654457..15654664 37..244 1040 100 Plus
3L 28103327 3L 15654721..15654911 245..435 955 100 Plus
3L 28103327 3L 15654360..15654396 1..37 185 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:54:33 has no hits.

MIP30130.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:55:35 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15651260..15651466 38..244 100 -> Plus
chr3L 15651523..15651711 245..433 100   Plus
chr3L 15651162..15651198 1..37 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:24 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 1..294 13..306 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:33 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 1..294 13..306 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:32:47 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 1..294 13..306 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:24 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 13..439 1..427 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:33 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 13..445 1..433 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:47 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 13..445 1..433 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:35 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15661358..15661564 38..244 100 -> Plus
3L 15661621..15661809 245..433 100   Plus
3L 15661260..15661296 1..37 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:35 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15661358..15661564 38..244 100 -> Plus
3L 15661621..15661809 245..433 100   Plus
3L 15661260..15661296 1..37 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:35 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15661358..15661564 38..244 100 -> Plus
3L 15661621..15661809 245..433 100   Plus
3L 15661260..15661296 1..37 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:33 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15654360..15654396 1..37 100 -> Plus
arm_3L 15654458..15654664 38..244 100 -> Plus
arm_3L 15654721..15654909 245..433 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:03 Download gff for MIP30130.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15654458..15654664 38..244 100 -> Plus
3L 15654721..15654909 245..433 100   Plus
3L 15654360..15654396 1..37 100 -> Plus

MIP30130.hyp Sequence

Translation from 0 to 305

> MIP30130.hyp
ENLKMWKIFLLLVLCILQLCHIDAQWSRVYCENIYNDCQRFTSRIGRFDE
TIDSFNRHCRRERRGRWNSVSRCEMEKATCLLIFRRCDDMSCNNIADVLE
L*

MIP30130.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ek-PA 97 CG7325-PA 1..97 5..101 538 100 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 5..99 190 35.1 Plus
Eig71Eb-PB 95 CG7355-PB 1..93 5..99 160 36.5 Plus
Eig71Eb-PA 95 CG7355-PA 1..93 5..99 160 36.5 Plus
Eig71Ei-PB 102 CG7327-PB 1..101 5..101 151 33.3 Plus

MIP30130.pep Sequence

Translation from 0 to 305

> MIP30130.pep
ENLKMWKIFLLLVLCILQLCHIDAQWSRVYCENIYNDCQRFTSRIGRFDE
TIDSFNRHCRRERRGRWNSVSRCEMEKATCLLIFRRCDDMSCNNIADVLE
L*

MIP30130.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24089-PA 122 GF24089-PA 39..120 16..99 156 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15920-PA 98 GG15920-PA 1..96 5..99 197 41.2 Plus
Dere\GG15917-PA 94 GG15917-PA 6..93 9..99 140 36.3 Plus
Dere\GG15921-PA 102 GG15921-PA 1..101 5..101 136 34.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ek-PA 97 CG7325-PA 1..97 5..101 538 100 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 5..99 190 35.1 Plus
Eig71Eb-PB 95 CG7355-PB 1..93 5..99 160 36.5 Plus
Eig71Eb-PA 95 CG7355-PA 1..93 5..99 160 36.5 Plus
Eig71Ei-PB 102 CG7327-PB 1..101 5..101 151 33.3 Plus
Eig71Ei-PA 102 CG7327-PA 1..101 5..101 151 33.3 Plus
Eig71Ec-PA 173 CG7608-PA 3..97 4..100 149 34.3 Plus
CG43082-PA 97 CG43082-PA 27..97 31..101 138 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13624-PA 97 GI13624-PA 1..96 5..99 134 35.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24996-PA 98 GL24996-PA 19..89 21..93 138 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20272-PA 95 GA20272-PA 19..95 21..99 160 38 Plus
Dpse\GA23777-PA 138 GA23777-PA 1..98 5..100 152 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25552-PA 97 GM25552-PA 1..97 5..101 352 92.8 Plus
Dsec\GM25551-PA 100 GM25551-PA 1..94 5..95 185 40.4 Plus
Dsec\GM25549-PA 94 GM25549-PA 1..93 5..99 153 38.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14566-PA 97 GD14566-PA 1..97 5..101 365 95.9 Plus
Dsim\GD14564-PA 98 GD14564-PA 1..96 5..99 194 41.2 Plus
Dsim\GD14562-PA 94 GD14562-PA 1..93 5..99 137 36.5 Plus
Dsim\GD14565-PA 102 GD14565-PA 1..101 5..101 134 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13962-PA 94 GJ13962-PA 1..92 5..99 150 34.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20719-PA 124 GK20719-PA 1..95 5..99 173 40.6 Plus
Dwil\GK15233-PA 98 GK15233-PA 1..96 5..99 171 39.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22268-PA 97 GE22268-PA 1..97 5..101 364 93.8 Plus
Dyak\GE23158-PA 97 GE23158-PA 1..97 5..101 357 92.8 Plus
Dyak\GE23156-PA 98 GE23156-PA 1..96 5..99 186 40.2 Plus
Dyak\GE22266-PA 98 GE22266-PA 1..96 5..99 185 40.2 Plus
Dyak\GE22264-PA 95 GE22264-PA 1..93 5..99 147 38.5 Plus