Clone MIP30205 Report

Search the DGRC for MIP30205

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:302
Well:5
Vector:pOT2
Associated Gene/TranscriptCG32198-RB
Protein status:MIP30205.pep: gold
Sequenced Size:488

Clone Sequence Records

MIP30205.complete Sequence

488 bp assembled on 2011-03-30

GenBank Submission: BT126238.1

> MIP30205.complete
CGGCACAGCTCAAGATGTGTTCCAAACTAACTCTTTTCCTGGGGTTAGTG
GCCCTCATTGCTGCTGTCTTTGCTCTTGATGATCCCACATCGCCGACATC
CCCAACATCTCCAACATCTCCAACTTCGCCGACTTCTCCAACTTCGCCGA
CTTCTCCAACTTCTCCCACTTCTCCTACATCACCAACTTCACCAACAACG
CCAGATGCCTCTACTGCCACCACTGCCGCCCCCTCTACGGCATCCACTAC
CACAGAAAGGACTCGCAGACGCAGGCGCAGGCGCAGGATAATCCGGATCC
GCAGGTTCAGGGGCGGCAACCGCCGTCGTGGATTCGGTAGACGCAGATTC
GGTGGTCGCCGGTTCGGTGAGGGAGGTGTCCGTGAAGTCGTGATCCGTGA
GCGCGGATTGGAGCGCCTCCTTTAAGATCTATAACGAAAACATTATTAAA
ATAAATCAAAATATCAATTTAAAAAAAAAAAAAAAAAA

MIP30205.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18516578..18517047 1..470 2350 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18526976..18527446 1..471 2355 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18520076..18520546 1..471 2355 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:54:53 has no hits.

MIP30205.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:55:45 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18516775..18517047 198..470 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 11:17:28 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
CG32198-RB 1..411 15..425 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:00:43 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
CG32198-RB 1..411 15..425 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:33:00 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
CG32198-RB 1..411 15..425 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 11:17:28 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
CG32198-RB 1..411 15..425 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:00:43 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
CG32198-RB 1..470 1..470 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:33:00 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
CG32198-RB 1..470 1..470 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:45 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18526976..18527445 1..470 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:45 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18526976..18527445 1..470 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:45 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18526976..18527445 1..470 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:00:43 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18520076..18520545 1..470 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:08 Download gff for MIP30205.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18520076..18520545 1..470 100   Plus

MIP30205.hyp Sequence

Translation from 2 to 424

> MIP30205.hyp
AQLKMCSKLTLFLGLVALIAAVFALDDPTSPTSPTSPTSPTSPTSPTSPT
SPTSPTSPTSPTSPTTPDASTATTAAPSTASTTTERTRRRRRRRRIIRIR
RFRGGNRRRGFGRRRFGGRRFGEGGVREVVIRERGLERLL*

MIP30205.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32198-PB 136 CG32198-PB 1..136 5..140 691 100 Plus
CG12522-PA 137 CG12522-PA 5..132 9..138 198 45.2 Plus
CG15741-PA 135 CG15741-PA 6..107 16..109 187 42.2 Plus
CG32071-PA 150 CG32071-PA 15..149 9..138 184 44.4 Plus
CG15741-PA 135 CG15741-PA 7..106 11..109 173 43 Plus
nol-PA 130 CG32077-PA 1..120 5..120 172 33.1 Plus

MIP30205.pep Sequence

Translation from 2 to 424

> MIP30205.pep
AQLKMCSKLTLFLGLVALIAAVFALDDPTSPTSPTSPTSPTSPTSPTSPT
SPTSPTSPTSPTSPTTPDASTATTAAPSTASTTTERTRRRRRRRRIIRIR
RFRGGNRRRGFGRRRFGGRRFGEGGVREVVIRERGLERLL*

MIP30205.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG32198-PB 136 CG32198-PB 1..136 5..140 691 100 Plus
CG12522-PA 137 CG12522-PA 5..132 9..138 198 45.2 Plus
CG15741-PA 135 CG15741-PA 6..107 16..109 187 42.2 Plus
CG32071-PA 150 CG32071-PA 15..149 9..138 184 44.4 Plus
CG15741-PA 135 CG15741-PA 7..106 11..109 173 43 Plus
nol-PA 130 CG32077-PA 1..120 5..120 172 33.1 Plus
CG12491-PA 157 CG12491-PA 1..144 5..120 160 36.1 Plus
CG34105-PA 157 CG34105-PA 1..144 5..120 160 36.1 Plus
CG12546-PA 117 CG12546-PA 22..102 35..115 144 42 Plus
CG14452-PA 117 CG14452-PA 22..102 35..115 144 42 Plus
CG14454-PB 120 CG14454-PB 4..102 11..115 142 38.1 Plus
CG14454-PA 120 CG14454-PA 4..102 11..115 142 38.1 Plus
CG32453-PB 120 CG32453-PB 4..102 11..115 142 38.1 Plus
CG32453-PA 120 CG32453-PA 4..102 11..115 142 38.1 Plus
CG11300-PA 157 CG11300-PA 1..156 5..136 136 31.9 Plus
CG14265-PB 119 CG14265-PB 2..119 8..124 135 33.9 Plus