Clone Sequence Records
MIP30216.complete Sequence
383 bp assembled on 2011-04-04
GenBank Submission: BT126311.1
> MIP30216.complete
CCAAGCTGCATCAACTCAAAATGAGGCTGCATCTTATACCACTGGTTGGA
CTCCTTGCACTGATTATGGCCCAATCCCAAGTACTCCTACCGGGACTTCG
CGTGCGACAGGTTCCCGTGCTCGAAATGGGCCAGATTCCAGTGGTGCAGT
ACCTGGACGCGGCCTCCACAGTCACTCCAGAGCTGGTAAAGGATCAGTTC
AGCAGGCGATTCACTACGCTGGCCAAACCCTTGGTCAGTGGTGCTGCTCC
CCAAACCAGTCTCCCAAATTTGTAATTTATTGTTACCGCCTAAGAGTCCA
TTTGATAAGCGAATATATACATAAATATTAAAGTTACGTCTTTATGCCAT
TAACTCTAGTTGCTAAAAAAAAAAAAAAAAAAA
MIP30216.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:55:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chr3R | 27901430 | chr3R | 1049799..1050162 | 1..364 | 1820 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:55:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 5224135..5224501 | 1..367 | 1835 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:18
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 31820162 | 3R | 4964966..4965332 | 1..367 | 1835 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 22:55:26 has no hits.
MIP30216.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:56:02 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chr3R | 1049799..1050162 | 1..364 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-04 12:37:57 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14664-RA | 1..255 | 21..275 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:01:17 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14664-RA | 1..255 | 21..275 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:33:27 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14664-RA | 1..255 | 21..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-04 12:37:57 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14664-RA | 1..360 | 5..364 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:01:17 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14664-RA | 1..360 | 5..364 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:33:27 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14664-RA | 1..360 | 5..364 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:56:02 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 5224135..5224498 | 1..364 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:56:02 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 5224135..5224498 | 1..364 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:56:02 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 5224135..5224498 | 1..364 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:01:17 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 1049857..1050220 | 1..364 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:04:31 Download gff for
MIP30216.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 4964966..4965329 | 1..364 | 100 | | Plus |
MIP30216.hyp Sequence
Translation from 0 to 330
> MIP30216.hyp
QAASTQNEAASYTTGWTPCTDYGPIPSTPTGTSRATGSRARNGPDSSGAV
PGRGLHSHSRAGKGSVQQAIHYAGQTLGQWCCSPNQSPKFVIYCYRLRVH
LISEYIHKY*
Sequence MIP30216.hyp has no blast hits.
MIP30216.pep Sequence
Translation from 2 to 274
> MIP30216.pep
KLHQLKMRLHLIPLVGLLALIMAQSQVLLPGLRVRQVPVLEMGQIPVVQY
LDAASTVTPELVKDQFSRRFTTLAKPLVSGAAPQTSLPNL*
MIP30216.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:45:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dere\GG12660-PA | 84 | GG12660-PA | 1..84 | 7..90 | 323 | 88.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14664-PC | 84 | CG14664-PC | 1..84 | 7..90 | 409 | 100 | Plus |
| CG14664-PB | 84 | CG14664-PB | 1..84 | 7..90 | 409 | 100 | Plus |
| CG14664-PA | 84 | CG14664-PA | 1..84 | 7..90 | 409 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:45:46
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM10793-PA | 84 | GM10793-PA | 1..84 | 7..90 | 396 | 95.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:45:47
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsim\GD19767-PA | 84 | GD19767-PA | 1..84 | 7..90 | 396 | 95.2 | Plus |
