Clone MIP30219 Report

Search the DGRC for MIP30219

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:302
Well:19
Vector:pOT2
Associated Gene/TranscriptCG42798-RA
Protein status:MIP30219.pep: gold
Sequenced Size:423

Clone Sequence Records

MIP30219.complete Sequence

423 bp assembled on 2011-04-08

GenBank Submission: BT126313.1

> MIP30219.complete
CACATTTCTCCAAAAATGAACTCGCTCATTGTAATTTTTGGATTTCTTTT
TATCTCAACTCAGATAGTCGCAACAACCGAGTCGGAATGTCCTGAAATCT
GTCTTGCAATTTACAGTCCGGTCTGTGAAGAAGCTATGATAAATGGAAAA
TTGGTTAGATGCTTATTCAGTAATAGCTGCGAAGCAGGTCGTAGCGCATG
TCTTCATGAAATAAATTGGCGCCAAAAAGAAGGAAAATGTGAAACTTCAC
CCGACCACTTATGCCGTCAATACCTTTCATCTAAAAATATTACTTCAAAA
GTAAGCTAATTCTTTTTATAGACTAGACTTATGACGTTAGTTTACTTACC
GAATTGACGTAGGTCGCAGAATAAAATATGGTTTGGCATATGTGTGTTTC
TACTATGAAAAAAAAAAAAAAAA

MIP30219.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13231346..13231559 1..214 1010 98.1 Plus
chr3R 27901430 chr3R 13231611..13231803 215..407 965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17406986..17407199 1..214 1070 100 Plus
3R 32079331 3R 17407251..17407446 215..410 980 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17147817..17148030 1..214 1070 100 Plus
3R 31820162 3R 17148082..17148277 215..410 980 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:15:08 has no hits.

MIP30219.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:16:01 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13231346..13231559 1..214 98 -> Plus
chr3R 13231611..13231803 215..407 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-11 16:15:25 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 1..294 16..309 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:05:05 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 1..294 16..309 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:36:37 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 1..294 16..309 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-11 16:15:24 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 3..409 1..407 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:05:05 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 3..409 1..407 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:36:37 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 3..409 1..407 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:01 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17406986..17407199 1..214 100 -> Plus
3R 17407251..17407443 215..407 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:01 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17406986..17407199 1..214 100 -> Plus
3R 17407251..17407443 215..407 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:01 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17406986..17407199 1..214 100 -> Plus
3R 17407251..17407443 215..407 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:05:05 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13232973..13233165 215..407 100   Plus
arm_3R 13232708..13232921 1..214 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:05:32 Download gff for MIP30219.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17147817..17148030 1..214 100 -> Plus
3R 17148082..17148274 215..407 100   Plus

MIP30219.pep Sequence

Translation from 0 to 308

> MIP30219.pep
HISPKMNSLIVIFGFLFISTQIVATTESECPEICLAIYSPVCEEAMINGK
LVRCLFSNSCEAGRSACLHEINWRQKEGKCETSPDHLCRQYLSSKNITSK
VS*

MIP30219.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42798-PA 97 CG42798-PA 1..97 6..102 514 100 Plus
CG42798-PB 57 CG42798-PB 1..57 46..102 310 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24780-PA 83 GI24780-PA 1..72 6..79 164 47.3 Plus

MIP30219.hyp Sequence

Translation from 0 to 308

> MIP30219.hyp
HISPKMNSLIVIFGFLFISTQIVATTESECPEICLAIYSPVCEEAMINGK
LVRCLFSNSCEAGRSACLHEINWRQKEGKCETSPDHLCRQYLSSKNITSK
VS*

MIP30219.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42798-PA 97 CG42798-PA 1..97 6..102 514 100 Plus
CG42798-PB 57 CG42798-PB 1..57 46..102 310 100 Plus