MIP30219.complete Sequence
423 bp assembled on 2011-04-08
GenBank Submission: BT126313.1
> MIP30219.complete
CACATTTCTCCAAAAATGAACTCGCTCATTGTAATTTTTGGATTTCTTTT
TATCTCAACTCAGATAGTCGCAACAACCGAGTCGGAATGTCCTGAAATCT
GTCTTGCAATTTACAGTCCGGTCTGTGAAGAAGCTATGATAAATGGAAAA
TTGGTTAGATGCTTATTCAGTAATAGCTGCGAAGCAGGTCGTAGCGCATG
TCTTCATGAAATAAATTGGCGCCAAAAAGAAGGAAAATGTGAAACTTCAC
CCGACCACTTATGCCGTCAATACCTTTCATCTAAAAATATTACTTCAAAA
GTAAGCTAATTCTTTTTATAGACTAGACTTATGACGTTAGTTTACTTACC
GAATTGACGTAGGTCGCAGAATAAAATATGGTTTGGCATATGTGTGTTTC
TACTATGAAAAAAAAAAAAAAAA
MIP30219.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:15:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 13231346..13231559 | 1..214 | 1010 | 98.1 | Plus |
chr3R | 27901430 | chr3R | 13231611..13231803 | 215..407 | 965 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17406986..17407199 | 1..214 | 1070 | 100 | Plus |
3R | 32079331 | 3R | 17407251..17407446 | 215..410 | 980 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:10:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 17147817..17148030 | 1..214 | 1070 | 100 | Plus |
3R | 31820162 | 3R | 17148082..17148277 | 215..410 | 980 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 23:15:08 has no hits.
MIP30219.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:16:01 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 13231346..13231559 | 1..214 | 98 | -> | Plus |
chr3R | 13231611..13231803 | 215..407 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-11 16:15:25 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 1..294 | 16..309 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:05:05 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 1..294 | 16..309 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:36:37 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 1..294 | 16..309 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-11 16:15:24 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 3..409 | 1..407 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:05:05 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 3..409 | 1..407 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:36:37 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 3..409 | 1..407 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:01 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17406986..17407199 | 1..214 | 100 | -> | Plus |
3R | 17407251..17407443 | 215..407 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:01 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17406986..17407199 | 1..214 | 100 | -> | Plus |
3R | 17407251..17407443 | 215..407 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:01 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17406986..17407199 | 1..214 | 100 | -> | Plus |
3R | 17407251..17407443 | 215..407 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:05:05 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13232973..13233165 | 215..407 | 100 | | Plus |
arm_3R | 13232708..13232921 | 1..214 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:05:32 Download gff for
MIP30219.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17147817..17148030 | 1..214 | 100 | -> | Plus |
3R | 17148082..17148274 | 215..407 | 100 | | Plus |
MIP30219.pep Sequence
Translation from 0 to 308
> MIP30219.pep
HISPKMNSLIVIFGFLFISTQIVATTESECPEICLAIYSPVCEEAMINGK
LVRCLFSNSCEAGRSACLHEINWRQKEGKCETSPDHLCRQYLSSKNITSK
VS*
MIP30219.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42798-PA | 97 | CG42798-PA | 1..97 | 6..102 | 514 | 100 | Plus |
CG42798-PB | 57 | CG42798-PB | 1..57 | 46..102 | 310 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:45:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI24780-PA | 83 | GI24780-PA | 1..72 | 6..79 | 164 | 47.3 | Plus |
MIP30219.hyp Sequence
Translation from 0 to 308
> MIP30219.hyp
HISPKMNSLIVIFGFLFISTQIVATTESECPEICLAIYSPVCEEAMINGK
LVRCLFSNSCEAGRSACLHEINWRQKEGKCETSPDHLCRQYLSSKNITSK
VS*
MIP30219.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42798-PA | 97 | CG42798-PA | 1..97 | 6..102 | 514 | 100 | Plus |
CG42798-PB | 57 | CG42798-PB | 1..57 | 46..102 | 310 | 100 | Plus |