BDGP Sequence Production Resources |
Search the DGRC for MIP30260
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 302 |
Well: | 60 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13081-RA |
Protein status: | MIP30260.pep: gold |
Sequenced Size: | 689 |
689 bp assembled on 2011-04-05
GenBank Submission: BT126220.1
> MIP30260.complete CACATCGGTCCTGCGGTCTTTTCGCTTGGGCAACATCATGTGCAAGTTCA CCAACCGGCTGTTTGTGTTCGCCCTGCTGCTTGTGGCACTTGGAAGAATT CTGGCCCAGCCCGTTGGCGGCAAGACTAGGCCAGGGAATTCGAGGAACGT GATCAGCGACTTGCTGGACGTCTTATACGACGACTATTCCGAGAATGGTT TTCAGCGCGAGGACATTCTATACGACCAACGGCAAAAGGGTGGGGAGAAC TATCAGTTCAAAGTGGATGGGGTCGTCATCGGAATGGCGCCTCAAATGAG CTCCAGCTTGCTCTACTCCATGGCAGAGTCCTACTTGAGTGAAATGTTGT TGCGCCAATCTACACCGGATCCAGATTCAACTCAGATGTACGAGAGGGAT CCTGAGACCGACACAGACTCTGGTTCCACCGAGGGCGTAACTAAGATTCC TGAGCTAGCCCAGATTAATTTGGAAAGCAGACAACATCAAATTGTAGCTT CTCAAACTGCCAGCCGATCTCCAACTCAACTGCTCCAATTGCTTAAGATG CTCAAAAGTTCTAAGGCCTAAAATGATATCTTTAGATACTATGACAAGAA ATTAGTCCTAAGTTCTTGGAAAATACATAGCAAATAAAATCATTCTTCGA ATTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 19539198..19539539 | 1..342 | 1695 | 99.7 | Plus |
chr2L | 23010047 | chr2L | 19539591..19539768 | 339..516 | 890 | 100 | Plus |
chr2L | 23010047 | chr2L | 19539830..19539968 | 516..654 | 695 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19540656..19540997 | 1..342 | 1710 | 100 | Plus |
2L | 23513712 | 2L | 19541049..19541226 | 339..516 | 890 | 100 | Plus |
2L | 23513712 | 2L | 19541288..19541429 | 516..657 | 710 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19540656..19540997 | 1..342 | 1710 | 100 | Plus |
2L | 23513712 | 2L | 19541049..19541226 | 339..516 | 890 | 100 | Plus |
2L | 23513712 | 2L | 19541288..19541429 | 516..657 | 710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 19539198..19539535 | 1..338 | 99 | -> | Plus |
chr2L | 19539591..19539768 | 339..516 | 100 | -> | Plus |
chr2L | 19539831..19539968 | 517..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13081-RA | 1..534 | 38..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13081-RA | 1..534 | 38..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13081-RA | 1..534 | 38..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13081-RA | 1..534 | 38..571 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13081-RA | 50..703 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13081-RA | 50..703 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19541289..19541426 | 517..654 | 100 | Plus | |
2L | 19541049..19541226 | 339..516 | 100 | -> | Plus |
2L | 19540656..19540993 | 1..338 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19541289..19541426 | 517..654 | 100 | Plus | |
2L | 19541049..19541226 | 339..516 | 100 | -> | Plus |
2L | 19540656..19540993 | 1..338 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19541289..19541426 | 517..654 | 100 | Plus | |
2L | 19541049..19541226 | 339..516 | 100 | -> | Plus |
2L | 19540656..19540993 | 1..338 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 19541049..19541226 | 339..516 | 100 | -> | Plus |
arm_2L | 19541289..19541426 | 517..654 | 100 | Plus | |
arm_2L | 19540656..19540993 | 1..338 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19540656..19540993 | 1..338 | 100 | -> | Plus |
2L | 19541049..19541226 | 339..516 | 100 | -> | Plus |
2L | 19541289..19541426 | 517..654 | 100 | Plus |
Translation from 0 to 570
> MIP30260.hyp TSVLRSFRLGNIMCKFTNRLFVFALLLVALGRILAQPVGGKTRPGNSRNV ISDLLDVLYDDYSENGFQREDILYDQRQKGGENYQFKVDGVVIGMAPQMS SSLLYSMAESYLSEMLLRQSTPDPDSTQMYERDPETDTDSGSTEGVTKIP ELAQINLESRQHQIVASQTASRSPTQLLQLLKMLKSSKA*
Translation from 1 to 570
> MIP30260.pep TSVLRSFRLGNIMCKFTNRLFVFALLLVALGRILAQPVGGKTRPGNSRNV ISDLLDVLYDDYSENGFQREDILYDQRQKGGENYQFKVDGVVIGMAPQMS SSLLYSMAESYLSEMLLRQSTPDPDSTQMYERDPETDTDSGSTEGVTKIP ELAQINLESRQHQIVASQTASRSPTQLLQLLKMLKSSKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14247-PA | 177 | GF14247-PA | 1..163 | 13..175 | 568 | 60.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21194-PA | 177 | GG21194-PA | 1..177 | 13..189 | 798 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13081-PB | 177 | CG13081-PB | 1..177 | 13..189 | 889 | 100 | Plus |
CG13081-PA | 177 | CG13081-PA | 1..177 | 13..189 | 889 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17659-PA | 101 | GI17659-PA | 1..91 | 13..111 | 217 | 46.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26087-PA | 178 | GL26087-PA | 1..177 | 13..188 | 510 | 62.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12031-PA | 178 | GA12031-PA | 1..177 | 13..188 | 510 | 62.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17363-PA | 216 | GM17363-PA | 28..216 | 1..189 | 972 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24221-PA | 177 | GD24221-PA | 1..177 | 13..189 | 898 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18226-PA | 167 | GJ18226-PA | 1..166 | 13..188 | 285 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24380-PA | 149 | GK24380-PA | 1..146 | 34..172 | 200 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13268-PA | 177 | GE13268-PA | 1..177 | 13..189 | 803 | 91 | Plus |