Clone MIP30909 Report

Search the DGRC for MIP30909

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:309
Well:9
Vector:pOT2
Associated Gene/TranscriptCG13000-RA
Protein status:MIP30909.pep: gold
Sequenced Size:534

Clone Sequence Records

MIP30909.complete Sequence

534 bp assembled on 2011-06-09

GenBank Submission: BT128723.1

> MIP30909.complete
AACATTCGACATGTCCATTAGCCTCTCTGAATTCTACCAATCCTCACTGA
CTTTCTGGAGCCATCTGATCCATATACTGCTGCAGTTCATCCAGACCAAC
TGCTGGAATCACATCACACAGAAGGAGCAGCAGCAAGAGGAACTCAACGA
ACCCTGTGCCATCTCAAAAACCATGGACGCCTTCGTGGAGGAGCAGCAAA
AGCGGGTGCAACGAAAATCCCACGAGTACGCCAAAGTGGAGCTACTGCAT
CGCCTGCTTGTCCAGCAGCAACTGCAGGAACTGGAGCAGCGCCGACTCAT
CCGATTGGCTCTGGCCAGGAGGCGACTGGACTACTCCAATTAGACTAGCC
GTGCAATTAGCTCATAATTTATTTAGATTTATAATTTACGCTTAGATTAT
GCCCAAGTATTCGCAATTTTTAAGTGGCCACATAATTAAGTGCCAACGAG
GCAAGTGCAAATAAAAAATGCAGAGAGTGCGGAAATTAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP30909.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16837539..16838025 487..1 2390 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16947961..16948450 490..1 2450 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16956059..16956548 490..1 2450 100 Minus
Blast to na_te.dros performed 2019-03-15 10:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2601..2790 88..290 127 56.7 Plus

MIP30909.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:37:40 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16837539..16838025 1..487 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-06-09 11:48:11 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 1..333 11..343 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:22:06 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 1..333 11..343 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:08:41 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 1..333 11..343 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-09 11:48:11 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 1..333 11..343 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:22:06 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 22..508 1..487 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:41 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
CG13000-RA 22..508 1..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:40 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
X 16947964..16948450 1..487 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:40 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
X 16947964..16948450 1..487 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:40 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
X 16947964..16948450 1..487 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:22:06 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16841997..16842483 1..487 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:07:42 Download gff for MIP30909.complete
Subject Subject Range Query Range Percent Splice Strand
X 16956062..16956548 1..487 100   Minus

MIP30909.hyp Sequence

Translation from 0 to 342

> MIP30909.hyp
TFDMSISLSEFYQSSLTFWSHLIHILLQFIQTNCWNHITQKEQQQEELNE
PCAISKTMDAFVEEQQKRVQRKSHEYAKVELLHRLLVQQQLQELEQRRLI
RLALARRRLDYSN*

MIP30909.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13000-PA 110 CG13000-PA 1..110 4..113 562 100 Plus

MIP30909.pep Sequence

Translation from 1 to 342

> MIP30909.pep
TFDMSISLSEFYQSSLTFWSHLIHILLQFIQTNCWNHITQKEQQQEELNE
PCAISKTMDAFVEEQQKRVQRKSHEYAKVELLHRLLVQQQLQELEQRRLI
RLALARRRLDYSN*

MIP30909.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18213-PA 110 GG18213-PA 1..110 4..113 386 86.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13000-PA 110 CG13000-PA 1..110 4..113 562 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22701-PA 109 GL22701-PA 1..109 4..113 211 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27925-PA 109 GA27925-PA 1..109 4..113 221 45.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13351-PA 110 GM13351-PA 1..110 4..113 408 90 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24492-PA 110 GD24492-PA 1..110 4..113 421 92.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15630-PA 111 GE15630-PA 5..111 7..113 377 85 Plus