Clone MIP31096 Report

Search the DGRC for MIP31096

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:310
Well:96
Vector:pOT2
Associated Gene/TranscriptCG13862-RA
Protein status:MIP31096.pep: gold
Sequenced Size:506

Clone Sequence Records

MIP31096.complete Sequence

506 bp assembled on 2011-06-08

GenBank Submission: BT128709.1

> MIP31096.complete
CGCCCGAAGCGACGAGACATATTAAGAATCGGAAACGGAGAACCATGAAG
ACGATTTCGCTGCTAACTTTTGTGGTGATGATGCTCGGAGTGGCACTGAG
CTTGGTTTGGGCCGGCCCCGATGATGGCTACCTTTATGACCAGCCATCGG
GTGAGCAACTTCAGGAACTCCAGGTGATCTCTCCCCCCAGGAAGCTCCGG
CTAAAGCCACGTGTCTACCCAGGGCATCCCTCTCAGGCTTGCGGAAACGT
GGAGGCGACGGATCATGCCGCTGCCCTGACCACCTACCATGCCAACCGCC
CCCAGCCGCGTCGCATTTACAATCACCAGGAAGTCGAGGTGGACAGCTCG
TTCTTTGAGCCCACGCCGGATCGGATCGAGGAACTCAAGCGTATTCTCTT
GGATCAGCAATGAAATGTGGTTTACTTGGATGACGGAAAATTTGCGTGAA
ATAAAAGTCTGCTTATGTGAAAGAGAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

MIP31096.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18155759..18156160 74..475 1920 98.5 Plus
chr3R 27901430 chr3R 18155607..18155682 1..76 380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22332158..22332560 74..476 2015 100 Plus
3R 32079331 3R 22332006..22332081 1..76 380 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22072989..22073391 74..476 2015 100 Plus
3R 31820162 3R 22072837..22072912 1..76 380 100 Plus
Blast to na_te.dros performed on 2019-03-15 10:36:39 has no hits.

MIP31096.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:37:30 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18155607..18155680 1..74 100 -> Plus
chr3R 18155760..18156160 75..475 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-06-08 16:16:33 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 1..336 78..413 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:21:46 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 1..336 78..413 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:08:22 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 1..336 78..413 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-08 16:16:32 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 16..428 1..413 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:21:46 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 16..428 1..413 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:22 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
CG13862-RA 16..490 1..475 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:30 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22332159..22332559 75..475 100   Plus
3R 22332006..22332079 1..74 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:30 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22332159..22332559 75..475 100   Plus
3R 22332006..22332079 1..74 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:30 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22332159..22332559 75..475 100   Plus
3R 22332006..22332079 1..74 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:21:46 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18157728..18157801 1..74 100 -> Plus
arm_3R 18157881..18158281 75..475 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:07:35 Download gff for MIP31096.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22072990..22073390 75..475 100   Plus
3R 22072837..22072910 1..74 100 -> Plus

MIP31096.hyp Sequence

Translation from 2 to 412

> MIP31096.hyp
PEATRHIKNRKRRTMKTISLLTFVVMMLGVALSLVWAGPDDGYLYDQPSG
EQLQELQVISPPRKLRLKPRVYPGHPSQACGNVEATDHAAALTTYHANRP
QPRRIYNHQEVEVDSSFFEPTPDRIEELKRILLDQQ*

MIP31096.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13862-PA 111 CG13862-PA 1..111 26..136 590 100 Plus

MIP31096.pep Sequence

Translation from 44 to 412

> MIP31096.pep
MKTISLLTFVVMMLGVALSLVWAGPDDGYLYDQPSGEQLQELQVISPPRK
LRLKPRVYPGHPSQACGNVEATDHAAALTTYHANRPQPRRIYNHQEVEVD
SSFFEPTPDRIEELKRILLDQQ*

MIP31096.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18077-PA 177 GF18077-PA 70..177 16..122 261 58.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11118-PA 103 GG11118-PA 1..103 13..122 412 72.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13862-PA 111 CG13862-PA 1..111 12..122 590 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23214-PA 132 GL23214-PA 1..132 1..122 170 45.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12581-PB 122 GA12581-PB 1..122 11..122 233 46.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26413-PA 148 GM26413-PA 35..148 9..122 563 90.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20934-PA 111 GD20934-PA 1..111 12..122 547 91.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18980-PA 101 GK18980-PA 3..101 17..121 183 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10283-PA 111 GE10283-PA 1..111 12..122 514 83.8 Plus