Clone MIP31574 Report

Search the DGRC for MIP31574

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:315
Well:74
Vector:pOT2
Associated Gene/TranscriptCG43124-RA
Protein status:MIP31574.pep: gold
Sequenced Size:792

Clone Sequence Records

MIP31574.complete Sequence

792 bp assembled on 2011-06-08

GenBank Submission: BT128716.1

> MIP31574.complete
TTGAATTGCCGCATGGAACGATGAACACAGCAAGATGGATAGTACTGTGT
ATCGTTTTGATGTTTTACCAGGGATCTGCCCAGACTCTGGAGGAGGATTG
CGTAGACCACATGGAGCGGATTAATGGATCAAGCTATGCTCCCTGGCTGG
CTGAAATTCTATCGGATTCTAAAGTAATTTGCGCTGGAGCACTCATAAAT
AATCTTTATGTTCTAACAGCTGCGAGTTGTTTTAAAGAGAATGAAAAACT
AACTGTTCGCTTGGGCAGTGGCTATTTTGATAAAAGCTACGAAAATTTCC
GAGTAACAAAGGCTTACTTTTGGATGACACATTTCCCGGCCAACAATACG
AATAATTTGTGTATCTTTCGGTTGCAAACGGAAGTGGAATTTAAGACCCA
CATTCGACCGATGTGTATCACAAAAAGTCCTAAAAGCCTTGGATTGGCGA
CCACTTTTGAAATTATCAATGAAAAGCCCAAAATGTGGTACTTTTGTAAA
AACATAAAAGGTTTATTCTGTAAATATGTTTTCGGAGAAAATGAAGAAAA
ATGGCAGTCCAAACCCACTGGAAGTCCTTGGACTGAAACAATCTCAAACG
GTCCTTTCAAGGGACTTGTACGATATGGAATCCTGAGCTATCGTGATAAC
AAAACCTATGATGAGGTTTATATAAATGTTATGTCTCATATTAACTGGAT
AGCTCAAATCTCGTTAGAGATTGATATAAGTACTCCAGTCAAGAAAAAAG
AATATTAAATATTTAATGGAACAGTAAAAAAAAAAAAAAAAA

MIP31574.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24086803..24087325 775..251 2470 98.5 Minus
chr3R 27901430 chr3R 24087490..24087697 208..1 980 98.1 Minus
chr3R 27901430 chr3R 24087388..24087433 250..205 230 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28263870..28264395 776..251 2630 100 Minus
3R 32079331 3R 28264557..28264764 208..1 1025 99.5 Minus
3R 32079331 3R 28264455..28264500 250..205 230 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28004701..28005226 776..251 2630 100 Minus
3R 31820162 3R 28005388..28005595 208..1 1025 99.5 Minus
3R 31820162 3R 28005286..28005331 250..205 230 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:36:47 has no hits.

MIP31574.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:37:35 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24086803..24087325 251..775 98 <- Minus
chr3R 24087388..24087433 205..250 100 <- Minus
chr3R 24087494..24087697 1..204 98   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-06-08 16:44:37 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
CG43124-RA 1..738 21..758 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:21:53 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
CG43124-RA 1..738 21..758 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:08:32 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
CG43124-RA 1..738 21..758 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-08 16:44:36 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
CG43124-RA 10..767 1..758 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:21:53 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
CG43124-RA 10..767 1..758 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:32 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
CG43124-RA 10..784 1..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:35 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28263871..28264395 251..775 100 <- Minus
3R 28264455..28264500 205..250 100 <- Minus
3R 28264561..28264764 1..204 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:35 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28263871..28264395 251..775 100 <- Minus
3R 28264455..28264500 205..250 100 <- Minus
3R 28264561..28264764 1..204 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:35 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28263871..28264395 251..775 100 <- Minus
3R 28264455..28264500 205..250 100 <- Minus
3R 28264561..28264764 1..204 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:21:53 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24090283..24090486 1..204 100   Minus
arm_3R 24089593..24090117 251..775 100 <- Minus
arm_3R 24090177..24090222 205..250 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:07:32 Download gff for MIP31574.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28004702..28005226 251..775 100 <- Minus
3R 28005286..28005331 205..250 100 <- Minus
3R 28005392..28005595 1..204 100   Minus

MIP31574.pep Sequence

Translation from 2 to 757

> MIP31574.pep
ELPHGTMNTARWIVLCIVLMFYQGSAQTLEEDCVDHMERINGSSYAPWLA
EILSDSKVICAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFR
VTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCITKSPKSLGLAT
TFEIINEKPKMWYFCKNIKGLFCKYVFGENEEKWQSKPTGSPWTETISNG
PFKGLVRYGILSYRDNKTYDEVYINVMSHINWIAQISLEIDISTPVKKKE
Y*

MIP31574.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11497-PA 284 GF11497-PA 2..274 11..239 200 25.5 Plus
Dana\GF11026-PA 655 GF11026-PA 435..537 47..140 159 35.9 Plus
Dana\GF19774-PA 272 GF19774-PA 23..258 25..240 148 22.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16934-PA 251 GG16934-PA 18..245 22..236 196 27.7 Plus
Dere\GG16535-PA 281 GG16535-PA 9..273 13..235 194 26.2 Plus
Dere\GG16935-PA 279 GG16935-PA 11..274 18..236 193 25.1 Plus
Dere\GG20771-PA 275 GG20771-PA 3..268 12..233 189 25.7 Plus
Dere\GG20544-PA 278 GG20544-PA 16..253 18..238 180 27.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23917-PA 235 GH23917-PA 15..229 47..234 167 28.1 Plus
Dgri\GH14456-PA 359 GH14456-PA 134..233 47..142 158 34 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43124-PA 245 CG43124-PA 1..245 7..251 1324 100 Plus
CG43125-PA 258 CG43125-PA 1..249 7..243 298 33.1 Plus
CG34436-PA 270 CG34436-PA 1..260 7..242 210 27 Plus
CG30286-PB 277 CG30286-PB 3..268 12..233 196 27.3 Plus
CG33465-PC 488 CG33465-PC 10..261 17..233 194 28.6 Plus
CG43335-PA 281 CG43335-PA 1..158 7..143 180 32.9 Plus
CG30082-PB 280 CR30082-PB 52..275 47..237 178 28.9 Plus
CG30091-PA 526 CG30091-PA 5..282 12..242 178 27.4 Plus
CG33462-PA 300 CG33462-PA 10..154 14..142 171 32.4 Plus
CG43336-PA 279 CG43336-PA 49..274 46..236 167 26.3 Plus
CG30287-PA 284 CG30287-PA 10..277 13..233 167 24.2 Plus
CG30083-PB 279 CG30083-PB 9..269 17..247 166 28.8 Plus
CG30098-PA 264 CG30098-PA 11..156 15..153 165 30.6 Plus
CG43742-PB 474 CG43742-PB 7..268 13..251 161 27 Plus
CG18636-PA 349 CG18636-PA 14..281 17..236 158 24.7 Plus
CG4650-PB 299 CG4650-PB 12..261 17..236 156 23.3 Plus
CG33460-PA 275 CG33460-PA 23..148 25..150 155 34.6 Plus
CG30090-PA 291 CG30090-PA 52..276 47..236 154 26.1 Plus
CG33461-PB 287 CG33461-PB 1..157 2..139 153 28.7 Plus
CG30286-PC 152 CG30286-PC 3..142 12..131 152 30 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17488-PA 282 GL17488-PA 10..276 13..236 201 26.6 Plus
Dper\GL11857-PA 283 GL11857-PA 6..281 10..242 198 27 Plus
Dper\GL11858-PA 345 GL11858-PA 6..281 10..236 198 23.9 Plus
Dper\GL11321-PA 284 GL11321-PA 1..273 7..233 162 25.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24176-PA 282 GA24176-PA 10..276 13..236 206 26.6 Plus
Dpse\GA15642-PA 283 GA15642-PA 10..281 14..242 195 27 Plus
Dpse\GA25145-PA 345 GA25145-PA 6..281 10..236 195 24 Plus
Dpse\GA24175-PB 304 GA24175-PB 30..279 23..235 164 26.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21629-PA 520 GM21629-PA 5..278 12..242 226 29.4 Plus
Dsec\GM15715-PA 277 GM15715-PA 15..268 22..233 214 28.4 Plus
Dsec\GM21631-PA 291 GM21631-PA 52..290 47..249 192 27.6 Plus
Dsec\GM24244-PA 234 GM24244-PA 11..229 43..236 190 26.5 Plus
Dsec\GM20059-PA 263 GM20059-PA 20..256 24..235 178 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11131-PA 515 GD11131-PA 1..271 18..242 218 28.6 Plus
Dsim\GD12291-PA 290 GD12291-PA 10..251 14..236 199 26.9 Plus
Dsim\GD25604-PA 280 GD25604-PA 21..275 26..237 195 28.7 Plus
Dsim\GD25541-PA 263 GD25541-PA 11..256 15..235 187 26.3 Plus
Dsim\GD19034-PA 256 GD19034-PA 26..251 46..236 184 25.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21212-PA 268 GJ21212-PA 11..262 21..234 171 25.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10763-PA 672 GK10763-PA 446..548 47..140 156 36.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13707-PA 275 GE13707-PA 3..271 12..236 196 25.3 Plus
Dyak\GE11725-PA 296 GE11725-PA 11..273 15..236 193 28.9 Plus
Dyak\GE11796-PA 263 GE11796-PA 6..256 13..235 191 25.1 Plus
Dyak\GE11723-PA 522 GE11723-PA 3..275 23..248 191 26.9 Plus
Dyak\GE11730-PA 306 GE11730-PA 10..278 14..236 174 24.4 Plus

MIP31574.hyp Sequence

Translation from 2 to 757

> MIP31574.hyp
ELPHGTMNTARWIVLCIVLMFYQGSAQTLEEDCVDHMERINGSSYAPWLA
EILSDSKVICAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFR
VTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCITKSPKSLGLAT
TFEIINEKPKMWYFCKNIKGLFCKYVFGENEEKWQSKPTGSPWTETISNG
PFKGLVRYGILSYRDNKTYDEVYINVMSHINWIAQISLEIDISTPVKKKE
Y*

MIP31574.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG43124-PA 245 CG43124-PA 1..245 7..251 1324 100 Plus
CG43125-PA 258 CG43125-PA 1..249 7..243 298 33.1 Plus
CG34436-PA 270 CG34436-PA 1..260 7..242 210 27 Plus
CG30286-PB 277 CG30286-PB 3..268 12..233 196 27.3 Plus
CG33465-PC 488 CG33465-PC 10..261 17..233 194 28.6 Plus