Clone MIP31781 Report

Search the DGRC for MIP31781

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:317
Well:81
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG43115-RA
Protein status:MIP31781.pep: gold
Sequenced Size:745

Clone Sequence Records

MIP31781.complete Sequence

745 bp assembled on 2011-06-10

GenBank Submission: BT128744.1

> MIP31781.complete
ACTTTGAAAGTACAAAGTGAAATACTTTGAAAATAGAAATTTTTAAAATT
TTGTTGAAGTAATTTAGTGCTATTATGACCAACTTGATATGCGTTTCCTT
AGCTGGATTACTCCACGTGATCCAGTTCCTGGCGTTTTATTCCAGAAGTG
CCAATACTCCGGCACCGAAACTACCCTCGCTATTTGTGGGTCTTGCTGCG
ATGGATATTATATGGGACAATTGCTTCGTTCCCCGGAAACTTCAAAAGAG
GTCGGCTGTGATCAGGTGGATATACGAATTGATAGTGTCACACTTGCTAT
TGGGGCTTGTCCAGGTGTTTTGGAAGCCAGTGGATAATATATGTGTCATC
CTGATGAGACTCATAATACTCGGCACTGGCATCGTCTCGGAGACCAACTA
TGAAAACTACGAAAGCTACTGGGTGGGCTTTCTTACCGTGCCGTTGTCCC
TTCTGATCCTAGCAATAGCCGGCCAAGCCACTGACCATTTCTCCGTGTTA
CGCGCTTACAAAATGCAAAATGTGGGGGCCTTAAAGTATCCGACGAAGAG
GCTGCCGCATCGTTCCGATTCTGAGAGAGCACAGGGATCAGGCACGCCGA
CGGCGTCAGCAATAAAGGGAAACTTGTGATAGGCACGAGAATTCAATTGG
ATTCGTTTATTTAATGCAAGAAATAAAAAGATCATAATAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP31781.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5957956..5958645 688..1 3355 99.4 Minus
chrX 22417052 chrX 5746136..5746660 1..525 2235 95 Plus
chr2L 23010047 chr2L 6971305..6971471 61..232 435 84.9 Plus
chr2L 23010047 chr2L 6971494..6971681 276..460 380 81.4 Plus
chrX 22417052 chrX 5746709..5746804 538..631 370 94.8 Plus
chr2L 23010047 chr2L 6971808..6971917 553..662 340 87.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6065727..6066416 690..1 3420 99.7 Minus
X 23542271 X 5853761..5854285 1..525 2220 94.9 Plus
2L 23513712 2L 6972229..6972395 61..232 435 84.9 Plus
2L 23513712 2L 6972418..6972605 276..460 380 81.4 Plus
X 23542271 X 5854334..5854429 538..631 370 94.8 Plus
2L 23513712 2L 6972732..6972841 553..662 340 87.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6073825..6074514 690..1 3420 99.7 Minus
X 23527363 X 5861859..5862383 1..525 2220 94.8 Plus
2L 23513712 2L 6972229..6972395 61..232 445 84.8 Plus
X 23527363 X 5862432..5862527 538..631 380 94.7 Plus
2L 23513712 2L 6972454..6972605 309..460 370 82.8 Plus
2L 23513712 2L 6972732..6972841 553..662 340 87.2 Plus
X 23527363 X 5862527..5862563 645..681 155 94.5 Plus
Blast to na_te.dros performed 2019-03-15 10:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 3004..3082 3..81 133 66.2 Plus
hopper 1435 hopper DMTRDNA 1435bp Derived from X80025 (g510507) (Rel. 44, Last updated, Version 11). 650..706 67..10 116 69 Minus

MIP31781.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:44:29 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5957956..5958645 1..688 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-06-10 13:19:11 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
CG43115-RA 1..555 75..629 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:23:55 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
CG43115-RA 1..555 75..629 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:10:36 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
CG43115-RA 1..555 75..629 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-10 13:19:11 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
CG43115-RA 1..555 75..629 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:23:55 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
CG43115-RA 1..688 1..688 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:10:36 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
CG43115-RA 1..688 1..688 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:44:29 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
X 6065729..6066416 1..688 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:44:29 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
X 6065729..6066416 1..688 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:44:29 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
X 6065729..6066416 1..688 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:23:55 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5959762..5960449 1..688 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:08:30 Download gff for MIP31781.complete
Subject Subject Range Query Range Percent Splice Strand
X 6073827..6074514 1..688 99   Minus

MIP31781.hyp Sequence

Translation from 74 to 628

> MIP31781.hyp
MTNLICVSLAGLLHVIQFLAFYSRSANTPAPKLPSLFVGLAAMDIIWDNC
FVPRKLQKRSAVIRWIYELIVSHLLLGLVQVFWKPVDNICVILMRLIILG
TGIVSETNYENYESYWVGFLTVPLSLLILAIAGQATDHFSVLRAYKMQNV
GALKYPTKRLPHRSDSERAQGSGTPTASAIKGNL*

MIP31781.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG43115-PA 184 CG43115-PA 1..184 1..184 946 100 Plus
CG43136-PA 192 CG43136-PA 1..172 1..160 719 84.9 Plus

MIP31781.pep Sequence

Translation from 74 to 628

> MIP31781.pep
MTNLICVSLAGLLHVIQFLAFYSRSANTPAPKLPSLFVGLAAMDIIWDNC
FVPRKLQKRSAVIRWIYELIVSHLLLGLVQVFWKPVDNICVILMRLIILG
TGIVSETNYENYESYWVGFLTVPLSLLILAIAGQATDHFSVLRAYKMQNV
GALKYPTKRLPHRSDSERAQGSGTPTASAIKGNL*

MIP31781.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20310-PA 202 GF20310-PA 1..171 1..170 301 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10449-PA 151 GG10449-PA 3..85 61..142 259 63.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11029-PA 151 GH11029-PA 6..146 6..143 223 34 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG43115-PA 184 CG43115-PA 1..184 1..184 946 100 Plus
CG43136-PA 192 CG43136-PA 1..172 1..160 719 84.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17547-PA 206 GI17547-PA 1..177 1..172 204 29.9 Plus
Dmoj\GI17546-PA 142 GI17546-PA 1..141 1..138 171 26.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12599-PA 188 GM12599-PA 1..185 1..170 561 64 Plus
Dsec\GM16263-PA 171 GM16263-PA 1..144 1..143 484 66.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16219-PA 188 GD16219-PA 1..185 1..170 537 61.3 Plus
Dsim\GD16760-PA 161 GD16760-PA 1..143 1..143 529 73.4 Plus
Dsim\GD23443-PA 102 GD23443-PA 1..79 66..143 257 64.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15517-PA 207 GJ15517-PA 1..146 1..142 220 33.6 Plus
Dvir\GJ15506-PA 116 GJ15506-PA 1..111 33..143 159 34.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14264-PA 200 GE14264-PA 1..144 1..142 473 65.3 Plus