MIP32033.complete Sequence
387 bp assembled on 2011-08-19
GenBank Submission: BT128804.1
> MIP32033.complete
TAAAACAATTCAACCAGAACTCAGCATGGACCTCATTGTGCCACCGAACG
GACTCTATGAGATGCCACACCAACCAGAGTATCCGGATTATGAGGCGATG
AGAAGACCGGTAGAGTCGTTGCGCATGGTGAAGCAGAAGGAAGTTCTGGT
CGATAGGGAACTCGAGTTTTTCTTCAATACGGAAGATATAACGAAAGTCA
ATTCCGAGGTGTTTCGAGGTGTGACTAGTGGTCACAGCACAGAATTTGGG
ACTCGTTAGCGATTCGTTTTCGACTGGGGGCATGTTCCAGAATGATTGTA
ATATGGACGAAAATTTAAGATAAGATCTATCAGAATGAAATTTAAATTCA
AATTAAAAAGTTCCCCCTACTAAAAAAAAAAAAAAAA
MIP32033.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:52:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 1191958..1192330 | 371..1 | 1800 | 99.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:52:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 1297982..1298356 | 373..1 | 1810 | 99.5 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 1306080..1306454 | 373..1 | 1820 | 99.4 | Minus |
Blast to na_te.dros performed on 2019-03-15 10:52:32 has no hits.
MIP32033.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:53:26 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 1191958..1192330 | 1..371 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 16:32:35 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32811-RB | 1..234 | 26..259 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:28:08 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32811-RB | 1..234 | 26..259 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:14:47 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32811-RB | 1..234 | 26..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 16:32:34 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32811-RB | 32..402 | 1..369 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:28:08 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32811-RB | 32..404 | 1..371 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:14:47 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32811-RB | 32..404 | 1..371 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:26 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1297984..1298356 | 1..371 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:26 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1297984..1298356 | 1..371 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:26 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1297984..1298356 | 1..371 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:28:08 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 1192017..1192389 | 1..371 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:51 Download gff for
MIP32033.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1306082..1306454 | 1..371 | 99 | | Minus |
MIP32033.hyp Sequence
Translation from 0 to 258
> MIP32033.hyp
KTIQPELSMDLIVPPNGLYEMPHQPEYPDYEAMRRPVESLRMVKQKEVLV
DRELEFFFNTEDITKVNSEVFRGVTSGHSTEFGTR*
MIP32033.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32811-PB | 77 | CG32811-PB | 1..77 | 9..85 | 405 | 100 | Plus |
MIP32033.pep Sequence
Translation from 1 to 258
> MIP32033.pep
KTIQPELSMDLIVPPNGLYEMPHQPEYPDYEAMRRPVESLRMVKQKEVLV
DRELEFFFNTEDITKVNSEVFRGVTSGHSTEFGTR*
MIP32033.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:25:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12708-PA | 130 | GG12708-PA | 13..72 | 11..67 | 147 | 57.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32811-PB | 77 | CG32811-PB | 1..77 | 9..85 | 405 | 100 | Plus |