Clone MIP32146 Report

Search the DGRC for MIP32146

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:321
Well:46
Vector:pOT2
Associated Gene/TranscriptCG13962-RA
Protein status:MIP32146.pep: gold
Sequenced Size:648

Clone Sequence Records

MIP32146.complete Sequence

648 bp assembled on 2011-08-19

GenBank Submission: BT128806.1

> MIP32146.complete
ATGCGTTGTATGCTTATAGTATTTGCCATAGCTGCTGTAAGCCTTTCGTG
TGCTGCTCCTGCGAAATCGCAAAACGAGATGTTAGCTCATTTCTTTGACT
ATGCTGACACCCTCCGTGGCATTCAAATCCATAATATGATGTCACTCACC
ATCAAATTCGTGCAACAAGTTGTGGACACAGTTCCGCTTGAACAACGTGG
ACCGGGAACGGCTGCCCTCCAGGCCTATGCCAACAAGGGCAAGAGTCTCA
AACAGCGAGGCACAACTGGCGAGAAATATAACTATATCTACGAACTGCAA
CAGGTATTCGAGGGACTCAACAGCGAGCTGAGTCAATCGGCACCTGAATC
CCAGGTGATTGGAATGAGCCTGCTGGGTTTACTGGGCGTTAGCACTGAAT
TCGCCAATGAGAATGAGAAACTCCACAATAAGTTTGTCGAAGGTGCCACC
CAAATGAAAGCCATGTTGTCTCCGACCACAATAGCTCGGGAAAGTGAGCT
CCTCGAGGCGATCGACAAATACATCGCTTCCACTGATATACAGCAGCACG
AAGCTCTCTTTATGAAAGTCATGAGCTTCAAGGATAGGTACTAAGCTTAA
GTCAATAAAACGATTTACACAACATGGAATGAAAAAAAAAAAAAAAAA

MIP32146.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19812291..19812882 631..40 2825 98.5 Minus
chr2L 23010047 chr2L 19812944..19812981 38..1 190 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19813818..19814413 635..40 2980 100 Minus
2L 23513712 2L 19814474..19814512 39..1 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19813818..19814413 635..40 2980 100 Minus
2L 23513712 2L 19814474..19814512 39..1 195 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:52:37 has no hits.

MIP32146.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:53:29 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19812291..19812882 40..631 98 <- Minus
chr2L 19812943..19812981 1..39 97   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 17:01:32 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
CG13962-RA 1..459 136..594 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:28:16 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
CG13962-RA 1..459 136..594 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:14:55 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
CG13962-RA 1..459 136..594 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 17:01:31 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
CG13962-RA 25..655 1..631 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:28:16 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
CG13962-RA 21..651 1..631 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:14:55 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
CG13962-RA 21..651 1..631 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:29 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19813822..19814413 40..631 100 <- Minus
2L 19814474..19814512 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:29 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19813822..19814413 40..631 100 <- Minus
2L 19814474..19814512 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:29 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19813822..19814413 40..631 100 <- Minus
2L 19814474..19814512 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:28:16 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19813822..19814413 40..631 100 <- Minus
arm_2L 19814474..19814512 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:54 Download gff for MIP32146.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19813822..19814413 40..631 100 <- Minus
2L 19814474..19814512 1..39 100   Minus

MIP32146.pep Sequence

Translation from 0 to 593

> MIP32146.pep
MRCMLIVFAIAAVSLSCAAPAKSQNEMLAHFFDYADTLRGIQIHNMMSLT
IKFVQQVVDTVPLEQRGPGTAALQAYANKGKSLKQRGTTGEKYNYIYELQ
QVFEGLNSELSQSAPESQVIGMSLLGLLGVSTEFANENEKLHNKFVEGAT
QMKAMLSPTTIARESELLEAIDKYIASTDIQQHEALFMKVMSFKDRY*

MIP32146.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14430-PA 196 GF14430-PA 1..196 1..197 552 51.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21204-PA 151 GG21204-PA 1..151 46..197 483 64.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13962-PB 152 CG13962-PB 1..152 46..197 756 100 Plus
CG13962-PA 152 CG13962-PA 1..152 46..197 756 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26172-PA 197 GL26172-PA 1..197 1..197 500 48 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12661-PA 197 GA12661-PA 1..197 1..197 500 47.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16983-PA 192 GM16983-PA 9..192 14..197 881 87.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21731-PA 196 GD21731-PA 1..196 1..197 944 88.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13278-PA 152 GE13278-PA 1..152 46..197 642 79.6 Plus

MIP32146.hyp Sequence

Translation from 1 to 593

> MIP32146.hyp
MRCMLIVFAIAAVSLSCAAPAKSQNEMLAHFFDYADTLRGIQIHNMMSLT
IKFVQQVVDTVPLEQRGPGTAALQAYANKGKSLKQRGTTGEKYNYIYELQ
QVFEGLNSELSQSAPESQVIGMSLLGLLGVSTEFANENEKLHNKFVEGAT
QMKAMLSPTTIARESELLEAIDKYIASTDIQQHEALFMKVMSFKDRY*

MIP32146.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13962-PB 152 CG13962-PB 1..152 46..197 756 100 Plus
CG13962-PA 152 CG13962-PA 1..152 46..197 756 100 Plus