Clone MIP32234 Report

Search the DGRC for MIP32234

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:322
Well:34
Vector:pOT2
Associated Gene/TranscriptCG42729-RA
Protein status:MIP32234.pep: gold
Sequenced Size:648

Clone Sequence Records

MIP32234.complete Sequence

648 bp assembled on 2011-08-19

GenBank Submission: BT128801.1

> MIP32234.complete
CCTATTGAATGTGGCAATTGTTGATAGTCTTGGCCTGCCTGTTACCTGGC
TACCTCTGGGTGCAGGTGCAGGCGGTTTTTCTCGAGGAATGCAAAGGTGT
GATCATCAATAAGGTGACCAATGAGAATCAGGAGTGCAGTGAGTTTGTTC
ACTGCGATGGCGATGATTCCTACTACTGCAATGGGGATTGTCGTGAGGCC
GTGGAGTGTTATACCAATGTGGTTACCACACCGGTTACCACATTAAGACC
CATAGGAACCTCTACGGAACGAGCACCATCCGCAGAGCCAGTCAATACTA
CATCTACGACTTTAGCTACTACCACGCCAACAACGATTGCTGTAACCACG
ACTACAAGCCAAGTTCCGAGCACCGATGTCTATGTCATCTGCAAGACGAG
TGGAAGGAACGGGGTCTATCCCTATCCGGCAAATAGCAATTACTATTATC
AGTGTATTTCCGGTTATCTGTTGCTCCAGCAGTGCCCACAGAATTTCCAT
TTCGATGTCGCCCAGGGACAGTGCGTTGCCACAAAACCCAATCGTTCATC
GGGCTTACGTTTGTAAGATTCATATCCCAGTTTGTAATAAAGCAATTATC
AAAGGCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP32234.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15516848..15517454 607..1 2990 99.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15526910..15527516 607..1 3035 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15520010..15520616 607..1 3035 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:52:34 has no hits.

MIP32234.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:53:27 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15516848..15517454 1..607 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 16:55:44 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
CG42729-RA 1..558 9..566 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:28:13 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
CG42729-RA 1..558 9..566 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:14:51 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
CG42729-RA 1..558 9..566 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 16:55:44 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
CG42729-RA 1..558 9..566 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:28:13 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
CG42729-RA 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:14:51 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
CG42729-RA 1..607 1..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:27 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15526910..15527516 1..607 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:27 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15526910..15527516 1..607 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:27 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15526910..15527516 1..607 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:28:13 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15520010..15520616 1..607 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:52 Download gff for MIP32234.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15520010..15520616 1..607 100   Minus

MIP32234.hyp Sequence

Translation from 8 to 565

> MIP32234.hyp
MWQLLIVLACLLPGYLWVQVQAVFLEECKGVIINKVTNENQECSEFVHCD
GDDSYYCNGDCREAVECYTNVVTTPVTTLRPIGTSTERAPSAEPVNTTST
TLATTTPTTIAVTTTTSQVPSTDVYVICKTSGRNGVYPYPANSNYYYQCI
SGYLLLQQCPQNFHFDVAQGQCVATKPNRSSGLRL*

MIP32234.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42729-PA 185 CG42729-PA 1..185 1..185 1000 100 Plus
CG42728-PA 156 CG42728-PA 10..152 4..172 163 28.2 Plus
CG33263-PA 227 CG33263-PA 12..214 11..172 159 23.7 Plus

MIP32234.pep Sequence

Translation from 8 to 565

> MIP32234.pep
MWQLLIVLACLLPGYLWVQVQAVFLEECKGVIINKVTNENQECSEFVHCD
GDDSYYCNGDCREAVECYTNVVTTPVTTLRPIGTSTERAPSAEPVNTTST
TLATTTPTTIAVTTTTSQVPSTDVYVICKTSGRNGVYPYPANSNYYYQCI
SGYLLLQQCPQNFHFDVAQGQCVATKPNRSSGLRL*

MIP32234.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24466-PA 182 GF24466-PA 1..182 1..185 478 55.6 Plus
Dana\GF24465-PA 162 GF24465-PA 7..149 2..172 140 29 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13540-PA 274 GG13540-PA 97..274 7..185 772 82.7 Plus
Dere\GG13771-PA 202 GG13771-PA 7..189 2..172 162 23.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16814-PA 315 GH16814-PA 125..313 1..177 363 45.9 Plus
Dgri\GH19629-PA 192 GH19629-PA 24..181 21..172 138 28.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42729-PA 185 CG42729-PA 1..185 1..185 1000 100 Plus
CG42728-PA 156 CG42728-PA 10..152 4..172 163 28.2 Plus
CG33263-PA 227 CG33263-PA 12..214 11..172 159 23.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12218-PA 186 GI12218-PA 17..182 20..176 377 49.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20587-PA 188 GL20587-PA 1..188 7..185 478 53.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25521-PA 194 GA25521-PA 1..194 1..185 471 54.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24483-PA 277 GM24483-PA 98..277 7..185 795 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12555-PA 155 GD12555-PA 1..155 32..185 634 90.3 Plus
Dsim\GD12664-PA 226 GD12664-PA 3..214 4..172 140 24.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11449-PA 228 GJ11449-PA 39..225 4..177 394 48.7 Plus
Dvir\GJ13591-PA 180 GJ13591-PA 13..169 5..172 140 28 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22839-PA 277 GE22839-PA 97..277 7..185 694 82.3 Plus
Dyak\GE19841-PA 277 GE19841-PA 97..277 7..185 637 83.4 Plus