Clone MIP32340 Report

Search the DGRC for MIP32340

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:323
Well:40
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG12661-RA
Protein status:MIP32340.pep: gold
Sequenced Size:548

Clone Sequence Records

MIP32340.complete Sequence

548 bp assembled on 2011-08-19

GenBank Submission: BT128805.1

> MIP32340.complete
AAATAAGGGCAGTCAAACGAAAATTACCAACCGACTTTTATATTTTCCAT
AAATTTTATACTACTCGAGATGGATTGTGACAATTCGAGTTTGGAGGAGA
AGCGAGAACGCGTTGACAATGCAATCCTAACCGCCATGGAGGATCTGGAT
CGGGATTATCTGCGCAAATTGCAGATCGAGATGCACAGATGTGCGACCGC
CTGTTGTGCGGATGCGGACGCGAATGCGGAGGCGGTGGAGCGGTGCATCG
ATCGCTGCCAAATCCGTTTGACCCGATCACGCTGCTTCGTACAGCAGGGT
ATATCCGATTTTGAGAATCGCCTAGAGAAGTGCATCCAGCAGTGCCGCCT
CAATGGATCCGATTATAGCTTGGAACGTTGCACCAGCAACTGCGTGGATA
GCCATGTGGGATTGTTGCCCGAAATGTTTAGGGCTATGCGAGATACCCTG
GAGAAAGGTGTTTAGCAAAACAGAACACTTATGGTTTGATTTAATTAAAA
TTATATTCGTTGGATTTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP32340.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8814851..8815367 517..1 2585 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8923171..8923687 517..1 2585 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8931269..8931785 517..1 2585 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:56:14 has no hits.

MIP32340.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:10 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8814849..8815367 1..519 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 10:16:10 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
CG12661-RA 1..396 70..465 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:29:41 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
CG12661-RA 1..396 70..465 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:05 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
CG12661-RA 1..396 70..465 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 10:16:10 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
CG12661-RA 1..396 70..465 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:29:41 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
CG12661-RA 1..517 1..517 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:05 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
CG12661-RA 1..517 1..517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:10 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
X 8923169..8923687 1..519 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:10 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
X 8923169..8923687 1..519 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:10 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
X 8923169..8923687 1..519 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:29:41 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8817202..8817720 1..519 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:27 Download gff for MIP32340.complete
Subject Subject Range Query Range Percent Splice Strand
X 8931267..8931785 1..519 99   Minus

MIP32340.hyp Sequence

Translation from 69 to 464

> MIP32340.hyp
MDCDNSSLEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADAD
ANAEAVERCIDRCQIRLTRSRCFVQQGISDFENRLEKCIQQCRLNGSDYS
LERCTSNCVDSHVGLLPEMFRAMRDTLEKGV*

MIP32340.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG12661-PB 131 CG12661-PB 1..131 1..131 695 100 Plus
CG12661-PA 131 CG12661-PA 1..131 1..131 695 100 Plus
CG5323-PA 146 CG5323-PA 2..139 8..130 287 34.8 Plus
CG5327-PA 149 CG5327-PA 2..139 8..130 260 32.6 Plus

MIP32340.pep Sequence

Translation from 69 to 464

> MIP32340.pep
MDCDNSSLEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADAD
ANAEAVERCIDRCQIRLTRSRCFVQQGISDFENRLEKCIQQCRLNGSDYS
LERCTSNCVDSHVGLLPEMFRAMRDTLEKGV*

MIP32340.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19183-PA 134 GF19183-PA 1..134 1..131 458 64.9 Plus
Dana\GF11974-PA 146 GF11974-PA 2..139 8..130 287 35.5 Plus
Dana\GF11975-PA 153 GF11975-PA 2..140 8..131 238 31.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19017-PA 131 GG19017-PA 1..131 1..131 546 90.8 Plus
Dere\GG21909-PA 146 GG21909-PA 2..139 8..130 282 35.5 Plus
Dere\GG21910-PA 149 GG21910-PA 2..139 8..130 241 32.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20300-PA 146 GH20300-PA 2..139 8..130 281 34.8 Plus
Dgri\GH20301-PA 148 GH20301-PA 2..140 8..131 244 32.4 Plus
Dgri\GH25050-PA 148 GH25050-PA 2..140 8..131 244 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG12661-PB 131 CG12661-PB 1..131 1..131 695 100 Plus
CG12661-PA 131 CG12661-PA 1..131 1..131 695 100 Plus
CG5323-PA 146 CG5323-PA 2..139 8..130 287 34.8 Plus
CG5327-PA 149 CG5327-PA 2..139 8..130 260 32.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19971-PA 154 GI19971-PA 2..140 8..131 231 31.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17027-PA 146 GL17027-PA 2..139 8..130 286 37 Plus
Dper\GL17028-PA 153 GL17028-PA 2..139 8..130 245 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18804-PA 146 GA18804-PA 2..139 8..130 286 37 Plus
Dpse\GA18807-PA 153 GA18807-PA 2..139 8..130 244 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13692-PA 131 GM13692-PA 1..131 1..131 567 93.9 Plus
Dsec\GM21900-PA 146 GM21900-PA 2..139 8..130 280 34.8 Plus
Dsec\GM21901-PA 149 GM21901-PA 2..139 8..130 240 32.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16092-PA 131 GD16092-PA 1..131 1..131 560 92.4 Plus
Dsim\GD11396-PA 146 GD11396-PA 2..139 8..130 280 34.8 Plus
Dsim\GD11397-PA 149 GD11397-PA 2..139 8..130 240 32.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15392-PA 134 GJ15392-PA 3..134 4..131 390 54.5 Plus
Dvir\GJ21219-PA 146 GJ21219-PA 2..139 8..130 287 35.5 Plus
Dvir\GJ21220-PA 154 GJ21220-PA 2..140 8..131 248 33.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16197-PA 136 GK16197-PA 3..136 4..131 431 58.2 Plus
Dwil\GK21965-PA 152 GK21965-PA 2..139 8..130 239 31.9 Plus
Dwil\GK21964-PA 125 GK21964-PA 2..121 8..112 225 32.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17426-PA 132 GE17426-PA 3..132 2..131 525 89.2 Plus
Dyak\GE11983-PA 146 GE11983-PA 2..139 8..130 284 35.5 Plus
Dyak\GE11984-PA 149 GE11984-PA 2..139 8..130 240 32.6 Plus