Clone MIP32344 Report

Search the DGRC for MIP32344

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:323
Well:44
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG9669-RA
Protein status:MIP32344.pep: gold
Sequenced Size:347

Clone Sequence Records

MIP32344.complete Sequence

347 bp assembled on 2011-08-19

GenBank Submission: BT128798.1

> MIP32344.complete
AATTAAAGCTAAAATTCAATTATGGACGTAATGCAGCGCTACGTATCGCC
CGTGAACCCGGCCGTTTTTCCCCACCTCGCCACCGTGCTTTTGGTCATCG
GAACCTTCTTCACCGCCTGGTTCTTCATCTTTGTGGTGTCTCGAAAGAGC
TCTAAGGAAAGCACCTTGATAAAGGAACTGCTGATTAGCCTGTGCGCCTC
CATTTTCCTGGGATTCGGCATTGTTTTCCTGCTTCTAACCGTCGGTATTT
ACGTATGAGATAAGACACCATTCCGCATAGAAATAAACTGAAGATCTGAT
CGTGGGCGTTAACATACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP32344.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16834074..16834370 317..21 1470 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16844565..16844862 318..21 1490 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16837665..16837962 318..21 1490 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:56:16 has no hits.

MIP32344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:12 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16834074..16834370 21..317 99 <- Minus
chr3L 16834428..16834447 1..20 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 12:29:12 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RB 1..237 22..258 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:29:43 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 1..237 22..258 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:10 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 1..237 22..258 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 12:29:12 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 53..367 1..315 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:29:43 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 53..367 1..315 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:10 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 53..367 1..315 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:12 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16844566..16844862 21..317 100 <- Minus
3L 16844920..16844939 1..20 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:12 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16844566..16844862 21..317 100 <- Minus
3L 16844920..16844939 1..20 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:12 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16844566..16844862 21..317 100 <- Minus
3L 16844920..16844939 1..20 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:29:43 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16837666..16837962 21..317 100 <- Minus
arm_3L 16838020..16838039 1..20 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:28 Download gff for MIP32344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16837666..16837962 21..317 100 <- Minus
3L 16838020..16838039 1..20 100   Minus

MIP32344.hyp Sequence

Translation from 21 to 257

> MIP32344.hyp
MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKESTLI
KELLISLCASIFLGFGIVFLLLTVGIYV*

MIP32344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG9669-PB 78 CG9669-PB 1..78 1..78 388 100 Plus
CG9669-PA 78 CG9669-PA 1..78 1..78 388 100 Plus

MIP32344.pep Sequence

Translation from 21 to 257

> MIP32344.pep
MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKESTLI
KELLISLCASIFLGFGIVFLLLTVGIYV*

MIP32344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10500-PA 78 GF10500-PA 1..78 1..78 375 94.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15847-PA 78 GG15847-PA 1..78 1..78 386 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14902-PA 78 GH14902-PA 1..78 1..78 371 92.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
kud-PB 78 CG9669-PB 1..78 1..78 388 100 Plus
kud-PA 78 CG9669-PA 1..78 1..78 388 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12877-PA 78 GI12877-PA 1..78 1..78 304 92.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20700-PA 75 GL20700-PA 1..75 4..78 352 92 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21952-PA 83 GA21952-PA 7..83 2..78 354 89.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24363-PA 78 GM24363-PA 1..78 1..78 389 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12439-PA 78 GD12439-PA 1..78 1..78 389 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13018-PA 78 GJ13018-PA 1..78 1..78 305 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17580-PA 78 GK17580-PA 1..78 1..78 374 93.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22186-PA 78 GE22186-PA 1..78 1..78 389 100 Plus