Clone MIP32353 Report

Search the DGRC for MIP32353

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:323
Well:53
Vector:pOTB7_DraIII
Associated Gene/TranscriptGNBP-like3-RA
Protein status:MIP32353.pep: gold
Sequenced Size:518

Clone Sequence Records

MIP32353.complete Sequence

518 bp assembled on 2011-08-19

GenBank Submission: BT128820.1

> MIP32353.complete
AAATCCAGTTACTATCGCCATGGCGCAAAACTCAAAGTTAACAATCTATC
TGTTCCTAGTCGCAATTTCCGTGGGCTCCAGCCTGTCCTACGATGTGCCC
AAGGCCACCGTCAAGGTCAACTCACCGAAGGGATTCGAAGTCTCCATTCC
GGATGAGCCAGGCATTTCCCTATTCGCTTTTCACGGCAAGGTCAACGAGG
AAATGGACGATCTGAGCGATCAGACCTGGGCCGCCGATGTGGTCAGTTCA
CGCAATGGACGCTGGACTTATCGCAACCGGAACCATCAGCTTAGACCCGG
AGATGTTCTGTACTATTGGACAACGGCGCGTTACCATGGAGTCGACTATC
ACAACTACAACCAGAGGTATGTGGTTGGGCAGGGGGATTCCCAGAGAATC
GATGTCAACGGCTCCAACGGCGGTCGCCAGCCGATTGTGGCCAACGGCCA
TAATACGTTCAATATATATGTACAATAAACTATGCTTGAACAAAAAAAAA
AAAAAAAAAAAAAAAAAA

MIP32353.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16413100..16413589 1..490 2390 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20526314..20526807 1..494 2455 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20527513..20528006 1..494 2455 99.7 Plus
Blast to na_te.dros performed on 2019-03-15 10:56:23 has no hits.

MIP32353.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:15 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16413100..16413589 1..491 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 13:50:18 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13422-RA 1..459 20..478 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:29:53 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13422-RA 1..459 20..478 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:15 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
GNBP-like3-RA 1..459 20..478 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 13:50:18 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13422-RA 1..477 14..491 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:29:53 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13422-RA 20..509 1..491 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:15 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
GNBP-like3-RA 4..493 1..491 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:15 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20526314..20526803 1..491 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:15 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20526314..20526803 1..491 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:15 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20526314..20526803 1..491 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:29:53 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16413819..16414308 1..491 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:33 Download gff for MIP32353.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20527513..20528002 1..491 99   Plus

MIP32353.hyp Sequence

Translation from 0 to 477

> MIP32353.hyp
NPVTIAMAQNSKLTIYLFLVAISVGSSLSYDVPKATVKVNSPKGFEVSIP
DEPGISLFAFHGKVNEEMDDLSDQTWAADVVSSRNGRWTYRNRNHQLRPG
DVLYYWTTARYHGVDYHNYNQRYVVGQGDSQRIDVNGSNGGRQPIVANGH
NTFNIYVQ*

MIP32353.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
GNBP-like3-PA 152 CG13422-PA 1..152 7..158 814 100 Plus
GNBP3-PA 490 CG5008-PA 26..121 30..125 317 59.4 Plus
CG12780-PA 100 CG12780-PA 4..96 30..121 316 61.3 Plus
CG30148-PB 124 CG30148-PB 4..121 13..130 284 44.1 Plus
CG30148-PA 124 CG30148-PA 4..121 13..130 284 44.1 Plus

MIP32353.pep Sequence

Translation from 1 to 477

> MIP32353.pep
NPVTIAMAQNSKLTIYLFLVAISVGSSLSYDVPKATVKVNSPKGFEVSIP
DEPGISLFAFHGKVNEEMDDLSDQTWAADVVSSRNGRWTYRNRNHQLRPG
DVLYYWTTARYHGVDYHNYNQRYVVGQGDSQRIDVNGSNGGRQPIVANGH
NTFNIYVQ*

MIP32353.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12269-PA 148 GF12269-PA 5..148 15..158 633 78.5 Plus
Dana\GF24364-PA 492 GF24364-PA 17..121 17..125 318 54.1 Plus
Dana\GF12664-PA 123 GF12664-PA 2..116 11..125 313 48.7 Plus
Dana\GF19806-PA 102 GF19806-PA 4..96 30..122 290 55.9 Plus
Dana\GF23634-PA 492 GF23634-PA 9..110 19..121 153 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22037-PA 152 GG22037-PA 1..152 7..158 721 87.5 Plus
Dere\GG14358-PA 486 GG14358-PA 22..128 30..132 326 57 Plus
Dere\GG10636-PA 100 GG10636-PA 3..96 29..121 312 59.6 Plus
Dere\GG20857-PA 123 GG20857-PA 14..123 22..131 286 48.2 Plus
Dere\GG13669-PA 492 GG13669-PA 8..111 18..121 148 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20840-PA 223 GH20840-PA 11..127 15..131 483 69.2 Plus
Dgri\GH15336-PA 484 GH15336-PA 8..108 17..117 297 49.5 Plus
Dgri\GH21065-PA 122 GH21065-PA 1..117 9..127 282 47.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
GNBP-like3-PA 152 CG13422-PA 1..152 7..158 814 100 Plus
GNBP3-PA 490 CG5008-PA 26..121 30..125 317 59.4 Plus
CG12780-PA 100 CG12780-PA 4..96 30..121 316 61.3 Plus
CG30148-PB 124 CG30148-PB 4..121 13..130 284 44.1 Plus
CG30148-PA 124 CG30148-PA 4..121 13..130 284 44.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20944-PA 159 GI20944-PA 3..158 6..157 488 60.3 Plus
Dmoj\GI20945-PA 125 GI20945-PA 3..120 6..123 405 63.6 Plus
Dmoj\GI12940-PA 487 GI12940-PA 1..115 7..125 332 52.1 Plus
Dmoj\GI18667-PA 124 GI18667-PA 2..117 12..127 306 50.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17665-PA 155 GL17665-PA 19..154 25..157 573 79.4 Plus
Dper\GL10856-PA 101 GL10856-PA 3..97 29..122 326 65.3 Plus
Dper\GL20727-PA 449 GL20727-PA 1..121 7..125 321 51.2 Plus
Dper\GL16809-PA 124 GL16809-PA 3..123 12..132 318 51.2 Plus
Dper\GL22887-PA 499 GL22887-PA 10..145 17..152 153 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12275-PA 155 GA12275-PA 19..154 25..157 579 79.4 Plus
Dpse\GA15677-PA 124 GA15677-PA 3..123 12..132 320 51.2 Plus
Dpse\GA18590-PA 496 GA18590-PA 1..121 7..125 320 51.2 Plus
Dpse\GA11807-PA 101 GA11807-PA 3..97 29..122 319 64.2 Plus
Dpse\GA25695-PA 115 GA25695-PA 1..55 68..122 264 81.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22021-PA 152 GM22021-PA 1..152 7..158 757 92.1 Plus
Dsec\GM25102-PA 490 GM25102-PA 26..121 30..125 323 58.3 Plus
Dsec\GM20681-PA 100 GM20681-PA 4..96 30..121 301 61.3 Plus
Dsec\GM19784-PA 124 GM19784-PA 13..124 22..133 270 46.4 Plus
Dsec\GM14984-PA 492 GM14984-PA 2..111 11..121 147 33 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11519-PA 152 GD11519-PA 1..152 7..158 774 94.7 Plus
Dsim\GD14138-PA 490 GD14138-PA 26..121 30..125 326 58.3 Plus
Dsim\GD10160-PA 100 GD10160-PA 4..96 30..121 305 61.3 Plus
Dsim\GD25276-PA 124 GD25276-PA 13..124 22..133 274 46.4 Plus
Dsim\GNBP1-PA 492 GD14761-PA 2..111 11..121 144 33 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20666-PA 160 GJ20666-PA 4..159 6..157 515 59.6 Plus
Dvir\GJ13082-PA 491 GJ13082-PA 23..118 30..125 318 58.3 Plus
Dvir\GJ21683-PA 124 GJ21683-PA 2..117 12..127 296 48.3 Plus
Dvir\GJ11226-PA 500 GJ11226-PA 13..115 15..118 146 33.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19304-PA 149 GK19304-PA 13..148 17..156 479 65.7 Plus
Dwil\GK20626-PA 146 GK20626-PA 12..142 25..155 438 63.4 Plus
Dwil\GK16747-PA 497 GK16747-PA 21..135 30..146 314 51.3 Plus
Dwil\GK19325-PA 122 GK19325-PA 8..120 17..129 303 50.4 Plus
Dwil\GK20991-PA 116 GK20991-PA 7..114 17..124 284 50.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12117-PA 152 GE12117-PA 1..152 7..158 712 86.8 Plus
Dyak\GE20789-PA 490 GE20789-PA 26..121 30..125 316 58.3 Plus
Dyak\GE22957-PA 100 GE22957-PA 4..96 30..121 315 61.3 Plus
Dyak\GE13797-PA 124 GE13797-PA 14..116 23..125 277 49.5 Plus
Dyak\GNBP1-PA 492 GE19965-PA 9..111 19..121 147 32.7 Plus