Clone MIP32366 Report

Search the DGRC for MIP32366

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:323
Well:66
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG7046-RA
Protein status:MIP32366.pep: gold
Sequenced Size:581

Clone Sequence Records

MIP32366.complete Sequence

581 bp assembled on 2011-08-19

GenBank Submission: BT128816.1

> MIP32366.complete
AGTAGGCATTGACTTTGATTTCGCATTACTTATCATGTGCTCTATGTCAG
ACTACGGAGCACGCCCCAAAAAACCCATGAGCGCCTTCATGTTGTGGATG
AATTCCACCGGGCGCAAGAACATAAGAGCGGAGCATCCCGATTTTAGTGT
CCAAGAAGTGTCTGTGAAGGGCGGTGAGATGTGGCGAGCCATGGCCGATG
AGCACAAGATCGTGTGGCAGGAGTCGGCCAGCAAGGCAATGGCCGAGTAC
AAGGAGAAGTTGGAGAAGTGGAATGCCTTCAAGGAGCACCAGACGGAGTC
GTTTCCCCATATCTATGAAGCTCCGTTGTCCTCTCGATTCTCAAAAACTA
ACCAAAGGCCAACCCTTTTTGTGTACGACAGCAAGGATGAAGCAATGGCT
CCGATCTGCAGGACGTGCTTCTCAAAGGCCAAGTGCTTTCACTAAACGTT
TGCTAAATTATTGTTTAGTCACAAACAACCAGCAAAAGTTGCGAGATGTT
GTTCAATAAATTTAAATATTTATATTCAACTTGCTTACAACAAGTGTGCC
CAGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP32366.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18316828..18317337 44..553 2535 99.8 Plus
chr3R 27901430 chr3R 18315491..18315737 44..290 1025 94.3 Plus
chr3R 27901430 chr3R 18315766..18315885 340..459 330 85 Plus
chr3R 27901430 chr3R 18316652..18316694 1..43 215 100 Plus
chr3R 27901430 chr3R 18315325..18315367 1..43 200 97.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22493263..22493775 44..556 2565 100 Plus
3R 32079331 3R 22491927..22492173 44..290 1010 93.9 Plus
3R 32079331 3R 22492202..22492321 340..459 330 85 Plus
3R 32079331 3R 22493087..22493129 1..43 215 100 Plus
3R 32079331 3R 22491761..22491803 1..43 185 95.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22234094..22234606 44..556 2565 100 Plus
3R 31820162 3R 22232758..22233004 44..290 1010 93.9 Plus
3R 31820162 3R 22233033..22233152 340..459 330 85 Plus
3R 31820162 3R 22233918..22233960 1..43 215 100 Plus
3R 31820162 3R 22232592..22232634 1..43 185 95.3 Plus
Blast to na_te.dros performed on 2019-03-15 10:56:11 has no hits.

MIP32366.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:08 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18316652..18316694 1..43 100 -> Plus
chr3R 18316828..18317337 44..553 95   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 10:16:10 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
CG7046-RA 1..402 44..445 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:29:37 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
CG7046-RA 1..402 44..445 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:02 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
CG7046-RA 1..402 44..445 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 10:16:09 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
CG7046-RA 105..588 44..527 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:29:37 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
CG7046-RA 105..588 44..527 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:02 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
CG7046-RA 105..588 44..527 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:08 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22493087..22493129 1..43 100 -> Plus
3R 22493263..22493772 44..553 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:08 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22493087..22493129 1..43 100 -> Plus
3R 22493263..22493772 44..553 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:08 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22493087..22493129 1..43 100 -> Plus
3R 22493263..22493772 44..553 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:29:37 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18318809..18318851 1..43 100 -> Plus
arm_3R 18318985..18319494 44..553 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:26 Download gff for MIP32366.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22234094..22234603 44..553 100   Plus
3R 22233918..22233960 1..43 100 -> Plus

MIP32366.hyp Sequence

Translation from 0 to 444

> MIP32366.hyp
VGIDFDFALLIMCSMSDYGARPKKPMSAFMLWMNSTGRKNIRAEHPDFSV
QEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEKLEKWNAFKEHQTES
FPHIYEAPLSSRFSKTNQRPTLFVYDSKDEAMAPICRTCFSKAKCFH*

MIP32366.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG7046-PA 133 CG7046-PA 1..133 15..147 720 100 Plus
CG7046-PB 134 CG7046-PB 2..134 15..147 720 100 Plus
CG7045-PA 126 CG7045-PA 1..126 15..147 491 71.4 Plus
HmgD-PD 112 CG17950-PD 1..72 15..92 169 44.9 Plus
HmgD-PC 112 CG17950-PC 1..72 15..92 169 44.9 Plus

MIP32366.pep Sequence

Translation from 1 to 444

> MIP32366.pep
VGIDFDFALLIMCSMSDYGARPKKPMSAFMLWMNSTGRKNIRAEHPDFSV
QEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEKLEKWNAFKEHQTES
FPHIYEAPLSSRFSKTNQRPTLFVYDSKDEAMAPICRTCFSKAKCFH*

MIP32366.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18856-PA 209 GF18856-PA 1..78 15..92 204 44.9 Plus
Dana\GF13265-PA 111 GF13265-PA 4..63 21..83 160 49.2 Plus
Dana\GF12460-PA 728 GF12460-PA 554..620 21..90 159 41.4 Plus
Dana\GF11622-PA 111 GF11622-PA 3..73 19..92 146 36.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11142-PA 138 GG11142-PA 1..138 15..147 538 70.3 Plus
Dere\GG22136-PA 111 GG22136-PA 1..63 15..83 161 49.3 Plus
Dere\GG20749-PA 111 GG20749-PA 3..73 19..92 156 39.2 Plus
Dere\GG19998-PA 724 GG19998-PA 551..618 20..90 148 36.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21151-PA 744 GH21151-PA 559..633 21..98 169 39.7 Plus
Dgri\GH21124-PA 111 GH21124-PA 4..63 21..83 161 49.2 Plus
Dgri\GH20784-PA 111 GH20784-PA 3..73 19..92 155 39.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
tHMG2-PA 133 CG7046-PA 1..133 15..147 720 100 Plus
tHMG2-PB 134 CG7046-PB 2..134 15..147 720 100 Plus
tHMG1-PA 126 CG7045-PA 1..126 15..147 491 71.4 Plus
HmgD-PD 112 CG17950-PD 1..72 15..92 169 44.9 Plus
HmgD-PC 112 CG17950-PC 1..72 15..92 169 44.9 Plus
HmgD-PB 112 CG17950-PB 1..72 15..92 169 44.9 Plus
HmgD-PA 112 CG17950-PA 1..72 15..92 169 44.9 Plus
HmgZ-PD 111 CG17921-PD 3..73 19..92 162 39.2 Plus
HmgZ-PC 111 CG17921-PC 3..73 19..92 162 39.2 Plus
HmgZ-PA 111 CG17921-PA 3..73 19..92 162 39.2 Plus
HmgZ-PB 111 CG17921-PB 3..73 19..92 162 39.2 Plus
Ssrp-PA 723 CG4817-PA 554..620 21..90 153 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18728-PA 112 GI18728-PA 4..63 21..83 159 49.2 Plus
Dmoj\GI18750-PA 734 GI18750-PA 560..626 21..90 153 40 Plus
Dmoj\GI20867-PA 111 GI20867-PA 3..73 19..92 151 37.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23184-PA 82 GL23184-PA 3..77 20..94 182 41.3 Plus
Dper\GL17523-PA 113 GL17523-PA 1..75 15..92 164 41 Plus
Dper\GL11071-PA 727 GL11071-PA 556..623 22..92 160 42.3 Plus
Dper\GL16947-PA 111 GL16947-PA 4..63 21..83 157 49.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20056-PA 115 GA20056-PA 8..104 23..119 183 33 Plus
Dpse\GA27181-PA 82 GA27181-PA 3..77 20..94 181 41.3 Plus
Dpse\GA14726-PA 113 GA14726-PA 1..75 15..92 164 41 Plus
Dpse\GA30453-PC 111 GA30453-PC 4..63 21..83 157 49.2 Plus
Dpse\GA30453-PB 111 GA30453-PB 4..63 21..83 157 49.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26441-PA 137 GM26441-PA 1..137 15..147 518 67.9 Plus
Dsec\GM15859-PA 112 GM15859-PA 1..63 15..83 160 49.3 Plus
Dsec\GM15692-PA 111 GM15692-PA 3..73 19..92 156 39.2 Plus
Dsec\GM13209-PA 111 GM13209-PA 4..63 21..83 147 44.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20959-PA 137 GD20959-PA 1..137 15..147 499 66.4 Plus
Dsim\GD11309-PA 91 GD11309-PA 2..91 33..147 261 51.3 Plus
Dsim\GD15641-PA 65 GD15641-PA 1..56 31..86 189 66.1 Plus
Dsim\GD24602-PA 65 GD24602-PA 1..56 31..86 189 66.1 Plus
Dsim\GD11622-PA 112 GD11622-PA 1..63 15..83 160 49.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21748-PA 112 GJ21748-PA 4..63 21..83 160 49.2 Plus
Dvir\GJ21774-PA 729 GJ21774-PA 558..624 21..90 149 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15924-PA 111 GK15924-PA 4..63 21..83 159 49.2 Plus
Dwil\GK15658-PA 112 GK15658-PA 3..73 19..92 152 37.8 Plus
Dwil\GK22092-PA 730 GK22092-PA 555..620 22..90 141 37.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10308-PA 138 GE10308-PA 1..138 15..147 527 68.1 Plus
Dyak\HmgD-PA 111 GE12217-PA 1..63 15..83 161 49.3 Plus
Dyak\HmgZ-PA 111 GE13680-PA 3..73 19..92 156 39.2 Plus
Dyak\GE11532-PA 726 GE11532-PA 553..620 20..90 148 36.6 Plus