Clone MIP32409 Report

Search the DGRC for MIP32409

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:324
Well:9
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG13511-RA
Protein status:MIP32409.pep: gold
Sequenced Size:525

Clone Sequence Records

MIP32409.complete Sequence

525 bp assembled on 2011-08-19

GenBank Submission: BT128807.1

> MIP32409.complete
ATTTTCAGTGCATGCCCCGCCGCAAACATGAGCAGCACATGGATGGGCAG
AGCTCCAGAACCGGCCGACACGGAAATGGTGACCGTAACCACGCAGCCAA
ACTATGGGGTGGTGGTGACCCAGATACCCGTCTACACCCTGAACGGAGTG
GGGCCGGGCGCACATCCACTGGCTGTGGGCTGCAAGCCGATGAGGGTGAG
GTGTCCGTCCTGCAGGGGCGAGGTCACCACCAGTCTGGCCACGTCCCCCA
CCCGCAAGACCCACATGTGCGCTCTGACCTTGTATATCTGCTGCTGCTGG
CCCTTCATCTGCCTTCCCTACTTCATCAACTACTGCAAGAGTGTCCAGCA
CTACTGTCCCAACTGTGGATGCCACATTGGGAGCTATAGCATTTGATCAA
GTGCTGTGTCTCCGCACTGCCAAAAATGCCTTCCATGTCAAGACTTAATC
AAGATTAGCCATATATGTATACAGATACATAAAATAATAACGTTTTAAAT
CCAAAAAAAAAAAAAAAAAAAAAAA

MIP32409.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18546251..18546541 3..293 1440 99.7 Plus
chr2R 21145070 chr2R 18546599..18546806 293..500 1040 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22659687..22659977 3..293 1455 100 Plus
2R 25286936 2R 22660035..22660242 293..500 1040 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22660886..22661176 3..293 1455 100 Plus
2R 25260384 2R 22661234..22661441 293..500 1040 100 Plus
Blast to na_te.dros performed 2019-03-15 10:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 642..689 288..335 114 70.8 Plus
Fw3 3132 Fw3 FW3 3132bp 578..615 71..109 107 76.9 Plus

MIP32409.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:53:42 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18546250..18546541 1..293 99 -> Plus
chr2R 18546600..18546806 294..502 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 10:16:07 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
CG13511-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:28:53 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
CG13511-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:15:22 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
CG13511-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 10:16:07 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
CG13511-RA 1..369 28..396 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:28:53 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
CG13511-RA 1..493 8..502 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:15:22 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RC 1139..1637 1..502 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:42 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22659686..22659977 1..293 99 -> Plus
2R 22660036..22660242 294..502 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:42 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22659686..22659977 1..293 99 -> Plus
2R 22660036..22660242 294..502 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:42 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22659686..22659977 1..293 99 -> Plus
2R 22660036..22660242 294..502 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:28:53 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18547191..18547482 1..293 99 -> Plus
arm_2R 18547541..18547747 294..502 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:21 Download gff for MIP32409.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22660885..22661176 1..293 99 -> Plus
2R 22661235..22661441 294..502 99   Plus

MIP32409.pep Sequence

Translation from 0 to 395

> MIP32409.pep
IFSACPAANMSSTWMGRAPEPADTEMVTVTTQPNYGVVVTQIPVYTLNGV
GPGAHPLAVGCKPMRVRCPSCRGEVTTSLATSPTRKTHMCALTLYICCCW
PFICLPYFINYCKSVQHYCPNCGCHIGSYSI*

MIP32409.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11282-PA 113 GF11282-PA 18..113 36..131 429 82.3 Plus
Dana\GF11281-PA 129 GF11281-PA 55..128 57..130 195 45.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21062-PA 110 GG21062-PA 2..109 19..130 346 58.9 Plus
Dere\GG21061-PA 129 GG21061-PA 55..128 57..130 193 45.9 Plus
Dere\GG21063-PA 77 GG21063-PA 5..76 59..130 140 41.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19761-PA 135 GH19761-PA 61..134 57..130 200 45.9 Plus
Dgri\GH19762-PA 102 GH19762-PA 30..101 59..130 180 44.4 Plus
Dgri\GH19763-PA 193 GH19763-PA 121..192 59..130 145 41.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13511-PB 122 CG13511-PB 1..122 10..131 699 100 Plus
CG13511-PA 122 CG13511-PA 1..122 10..131 699 100 Plus
CG13510-PC 129 CG13510-PC 57..127 59..129 226 47.9 Plus
CG13510-PB 129 CG13510-PB 57..127 59..129 226 47.9 Plus
CG13510-PA 129 CG13510-PA 57..127 59..129 226 47.9 Plus
CG42566-PA 77 CG42566-PA 4..75 58..129 165 40.3 Plus
CG42566-PB 77 CG42566-PB 4..75 58..129 165 40.3 Plus
CG4250-PB 134 CG4250-PB 39..132 36..129 161 33.7 Plus
CG30269-PB 144 CG30269-PB 32..141 4..129 158 31 Plus
CG30269-PA 144 CG30269-PA 32..141 4..129 158 31 Plus
CG4250-PA 121 CG4250-PA 21..119 33..129 153 34 Plus
CG30273-PB 128 CG30273-PB 53..126 57..130 144 37.8 Plus
CG13516-PB 168 CG13516-PB 69..162 37..130 138 35.1 Plus
CG13516-PA 168 CG13516-PA 69..162 37..130 138 35.1 Plus
CG42565-PB 135 CG42565-PB 74..135 68..129 137 35.5 Plus
CG42565-PA 135 CG42565-PA 74..135 68..129 137 35.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20298-PA 135 GI20298-PA 61..134 57..130 194 45.9 Plus
Dmoj\GI20299-PA 103 GI20299-PA 31..102 59..130 187 44.4 Plus
Dmoj\GI20300-PA 165 GI20300-PA 47..164 22..130 177 35.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11362-PA 121 GL11362-PA 27..121 37..131 330 64.2 Plus
Dper\GL11361-PA 129 GL11361-PA 55..128 57..130 190 43.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12336-PA 121 GA12336-PA 27..121 37..131 334 65.3 Plus
Dpse\GA12335-PA 129 GA12335-PA 55..128 57..130 190 43.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15932-PA 99 GM15932-PA 1..57 10..66 249 84.2 Plus
Dsec\GM15931-PA 129 GM15931-PA 55..128 57..130 193 45.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11685-PA 122 GD11685-PA 1..122 10..131 601 93.4 Plus
Dsim\GD11684-PA 129 GD11684-PA 55..128 57..130 193 45.9 Plus
Dsim\GD11687-PA 77 GD11687-PA 4..76 58..130 131 39.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22026-PA 137 GJ22026-PA 63..136 57..130 194 44.6 Plus
Dvir\GJ22027-PA 152 GJ22027-PA 78..152 57..131 182 46.7 Plus
Dvir\GJ22029-PA 77 GJ22029-PA 5..76 59..130 138 37.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19389-PA 126 GK19389-PA 26..124 20..131 216 47.3 Plus
Dwil\GK21440-PA 130 GK21440-PA 56..129 57..130 190 43.2 Plus
Dwil\GK21443-PA 150 GK21443-PA 39..149 17..130 139 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14004-PA 139 GE14004-PA 1..139 10..131 417 65.2 Plus
Dyak\GE14003-PA 128 GE14003-PA 54..127 57..130 193 45.9 Plus
Dyak\GE14006-PA 77 GE14006-PA 5..76 59..130 131 38.9 Plus

MIP32409.hyp Sequence

Translation from 2 to 395

> MIP32409.hyp
FSACPAANMSSTWMGRAPEPADTEMVTVTTQPNYGVVVTQIPVYTLNGVG
PGAHPLAVGCKPMRVRCPSCRGEVTTSLATSPTRKTHMCALTLYICCCWP
FICLPYFINYCKSVQHYCPNCGCHIGSYSI*

MIP32409.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13511-PB 122 CG13511-PB 1..122 9..130 699 100 Plus
CG13511-PA 122 CG13511-PA 1..122 9..130 699 100 Plus
CG13510-PC 129 CG13510-PC 57..127 58..128 226 47.9 Plus
CG13510-PB 129 CG13510-PB 57..127 58..128 226 47.9 Plus
CG13510-PA 129 CG13510-PA 57..127 58..128 226 47.9 Plus