Clone MIP32431 Report

Search the DGRC for MIP32431

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:324
Well:31
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG15657-RA
Protein status:MIP32431.pep: gold
Sequenced Size:499

Clone Sequence Records

MIP32431.complete Sequence

499 bp assembled on 2011-08-19

GenBank Submission: BT128803.1

> MIP32431.complete
AGTTCAGTTCCACCAGGAAATTCAACAAATCCAAAATGCTGATCTACTAT
ATTTATAGTGTGCTCGAAGCCATTTCGTATGCGATCTACACAACAGTGGC
CACCATTTCGAGCATTGAACAGGCCCTAATCAACCTGATGATGTCCACAT
TTCTGTTTGTGCTTGGGATAGCGTGTCACCCGGTAATGGTGATTCCCCTG
ATGCTGGGAGGCTACTATATTCTACGCAACTGTTTGAATCGTCGGACCAA
GGCGCCAAGGCTGCAGAGTTCCGTGGATGGCGATGCCGGACTGATCACGG
CAGGACCACGTAAAGTGCCACGTTTTCCCTCTCATCGCAGCCTCGCTCTC
GGCGTTGACGCTCCCAAGGACAACTAAAAATGAGGATATTCTTGGGTACA
TACGAGTAGTCTCCTAACTTACAGACGTTAACAAATACAAAAGTGGGCGC
TCCCAAAACTTGGCTACATACGAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP32431.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17034075..17034425 471..121 1680 98.6 Minus
chr2R 21145070 chr2R 17034485..17034604 120..1 585 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21147620..21147970 471..121 1755 100 Minus
2R 25286936 2R 21148030..21148149 120..1 585 99.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21148819..21149169 471..121 1755 100 Minus
2R 25260384 2R 21149229..21149348 120..1 585 99.1 Minus
Blast to na_te.dros performed on 2019-03-15 10:52:13 has no hits.

MIP32431.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:53:16 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17034074..17034425 121..472 98 <- Minus
chr2R 17034485..17034604 1..120 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 14:31:00 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 1..342 36..377 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:27:42 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 1..342 36..377 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:14:28 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 1..342 36..377 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 14:31:00 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 5..475 1..472 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:27:42 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 5..475 1..472 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:14:28 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 5..475 1..472 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:16 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21147619..21147970 121..472 99 <- Minus
2R 21148030..21148149 1..120 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:16 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21147619..21147970 121..472 99 <- Minus
2R 21148030..21148149 1..120 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:53:16 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21147619..21147970 121..472 99 <- Minus
2R 21148030..21148149 1..120 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:27:42 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17035124..17035475 121..472 99 <- Minus
arm_2R 17035535..17035654 1..120 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:44 Download gff for MIP32431.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21148818..21149169 121..472 99 <- Minus
2R 21149229..21149348 1..120 99   Minus

MIP32431.hyp Sequence

Translation from 2 to 376

> MIP32431.hyp
FSSTRKFNKSKMLIYYIYSVLEAISYAIYTTVATISSIEQALINLMMSTF
LFVLGIACHPVMVIPLMLGGYYILRNCLNRRTKAPRLQSSVDGDAGLITA
GPRKVPRFPSHRSLALGVDAPKDN*

MIP32431.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15657-PB 113 CG15657-PB 1..113 12..124 573 100 Plus
CG15657-PA 113 CG15657-PA 1..113 12..124 573 100 Plus

MIP32431.pep Sequence

Translation from 2 to 376

> MIP32431.pep
FSSTRKFNKSKMLIYYIYSVLEAISYAIYTTVATISSIEQALINLMMSTF
LFVLGIACHPVMVIPLMLGGYYILRNCLNRRTKAPRLQSSVDGDAGLITA
GPRKVPRFPSHRSLALGVDAPKDN*

MIP32431.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12974-PA 106 GF12974-PA 5..104 17..124 247 46.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20800-PA 112 GG20800-PA 1..112 12..124 430 74.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21175-PA 118 GH21175-PA 5..97 17..115 187 42.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG15657-PB 113 CG15657-PB 1..113 12..124 573 100 Plus
CG15657-PA 113 CG15657-PA 1..113 12..124 573 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18769-PA 119 GI18769-PA 2..90 17..117 203 44.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10174-PA 111 GL10174-PA 2..92 17..106 170 37.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13875-PA 111 GA13875-PA 2..68 17..83 152 47.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15747-PA 113 GM15747-PA 1..113 12..124 502 84.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25222-PA 113 GD25222-PA 1..113 12..124 505 85 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21794-PA 117 GJ21794-PA 2..94 17..115 226 47.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19489-PA 128 GK19489-PA 1..108 12..115 190 39.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13740-PA 105 GE13740-PA 1..102 12..114 371 70.9 Plus