Clone MIP32448 Report

Search the DGRC for MIP32448

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:324
Well:48
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG13965-RA
Protein status:MIP32448.pep: gold
Sequenced Size:565

Clone Sequence Records

MIP32448.complete Sequence

565 bp assembled on 2011-08-19

GenBank Submission: BT128817.1

> MIP32448.complete
CTGGTTTCGACGCAGTATAGGTACACATACTATGTGTCAGGTGTGACGAT
AGGCATGGCGAAACTTGAACTGAAGCTGATTGGAATCGCTATATTCTTGG
TAGCCGCGCTCGAGGCTCAGGAAACCCCTGCGGCTGAATCATCTCCAGCG
TCCCCAACAGATGGCGAAACGTCTCCAGTTACAGAAGCCAGTTCCATCGG
AGAATTAACTCAGACCACAGAAGCGGGGTCGGAGGTCACAGAATCACCAA
CAAATAGCACCGATATGGTTAATAGCACGGACAACCCAGACCCGAACGGC
TCGCCTGACCCTGAAAATGGAGGAGATCCATTTGTGAAGCCAGGAAGCCA
TATAAAGGGACCTCGACACGTTAGAGCACATGATGGCTTCCACAGCCTGA
AGACGGAGAAGCATTGGGCAAGCTGGAACGATGCCTTTACCACGCCACGT
CCCTAGCTCATATGTATATCCCATTATACCCTTTCGTTTTGTGACCAATC
TCTGAAGATTATTGAATAAAAAACTAAATAATTTCACGAAAAAAAAAAAA
AAAAAAAAAAAAAAA

MIP32448.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19960100..19960556 534..78 2285 100 Minus
chr2L 23010047 chr2L 19960616..19960693 78..1 390 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19961759..19962215 534..78 2285 100 Minus
2L 23513712 2L 19962275..19962352 78..1 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19961759..19962215 534..78 2285 100 Minus
2L 23513712 2L 19962275..19962352 78..1 390 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:56:18 has no hits.

MIP32448.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:13 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19960616..19960693 1..78 100   Minus
chr2L 19960121..19960555 79..513 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 13:03:57 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13965-RA 1..402 55..456 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:29:46 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13965-RA 1..402 55..456 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:12 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13965-RA 1..402 55..456 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 13:03:57 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13965-RA 1..402 55..456 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:29:46 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13965-RA 1..535 1..535 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:12 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13965-RA 1..535 1..535 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:13 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961755..19962214 79..538 99 <- Minus
2L 19962275..19962352 1..78 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:13 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961755..19962214 79..538 99 <- Minus
2L 19962275..19962352 1..78 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:13 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961755..19962214 79..538 99 <- Minus
2L 19962275..19962352 1..78 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:29:46 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19961755..19962214 79..538 99 <- Minus
arm_2L 19962275..19962352 1..78 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:30 Download gff for MIP32448.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961755..19962214 79..538 99 <- Minus
2L 19962275..19962352 1..78 100   Minus

MIP32448.pep Sequence

Translation from 0 to 455

> MIP32448.pep
LVSTQYRYTYYVSGVTIGMAKLELKLIGIAIFLVAALEAQETPAAESSPA
SPTDGETSPVTEASSIGELTQTTEAGSEVTESPTNSTDMVNSTDNPDPNG
SPDPENGGDPFVKPGSHIKGPRHVRAHDGFHSLKTEKHWASWNDAFTTPR
P*

MIP32448.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15469-PA 148 GF15469-PA 15..134 33..148 218 42.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21602-PA 124 GG21602-PA 1..124 19..151 516 78.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13965-PA 133 CG13965-PA 1..133 19..151 703 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26687-PA 100 GL26687-PA 47..94 102..148 174 68.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29016-PA 100 GA29016-PA 47..94 102..148 174 68.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16976-PA 133 GM16976-PA 1..133 19..151 637 93.2 Plus
Dsec\GM18813-PA 125 GM18813-PA 1..125 27..151 593 92.8 Plus
Dsec\GM11933-PA 125 GM11933-PA 1..125 27..151 593 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21726-PA 133 GD21726-PA 1..133 19..151 625 92.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14663-PA 191 GJ14663-PA 144..185 105..146 174 69 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19049-PA 127 GK19049-PA 59..124 85..150 207 54.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12619-PA 133 GE12619-PA 1..133 19..151 509 75.9 Plus

MIP32448.hyp Sequence

Translation from 0 to 455

> MIP32448.hyp
LVSTQYRYTYYVSGVTIGMAKLELKLIGIAIFLVAALEAQETPAAESSPA
SPTDGETSPVTEASSIGELTQTTEAGSEVTESPTNSTDMVNSTDNPDPNG
SPDPENGGDPFVKPGSHIKGPRHVRAHDGFHSLKTEKHWASWNDAFTTPR
P*

MIP32448.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13965-PA 133 CG13965-PA 1..133 19..151 703 100 Plus