BDGP Sequence Production Resources |
Search the DGRC for MIP32452
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 324 |
Well: | 52 |
Vector: | pOTB7_DraIII |
Associated Gene/Transcript | Rpb11-RA |
Protein status: | MIP32452.pep: gold |
Sequenced Size: | 534 |
534 bp assembled on 2011-08-19
GenBank Submission: BT128818.1
> MIP32452.complete AGTCAACACTGTACCGGAGAATTTTGCTGAGCGTGCTGCTGATTTTAATA AACAATTTATAAGTTTTGCAGTAACTAACGAAAAGTAAGACATCAAAATG AACGCACCACCTACCTTTGAGTCATTTCTGCTCTATGAAGGCGAGAAAAA AATCATCAAGGAACTGGACACCAAAGTGACCAATGCGGCTATATTCACCA TAAACAAAGAGGATCACACGCTGGGCAACATGATCCGCAACCAACTGCTG AAGGATCCCAATGTTCTGTTTGCCGGCTACAAGGTTCCGCATCCTCTGGA GCACAAGTTCGTCATCCGCATCCAGACTACGGCCGATTATTCTCCGCAGG AAGCATTCATGAACGCCATAACCGATCTTCTAGCAGAATTATCTCTCTTC GAAGAGCGTTTCAAAGACGCCATCAAGGAGAAGAAGGAGGGCGGCGATTA ATCATATAATTACCAATTAATTCCTTAGTCTTATGAAAACCCAATAAAAG CTTCTTCTTCCGAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 17408508..17408687 | 416..237 | 885 | 99.4 | Minus |
chr2L | 23010047 | chr2L | 17408905..17409054 | 150..1 | 750 | 100 | Minus |
chr2L | 23010047 | chr2L | 17408351..17408446 | 511..416 | 480 | 100 | Minus |
chr2L | 23010047 | chr2L | 17408741..17408830 | 240..151 | 450 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 17409855..17410034 | 416..237 | 885 | 99.4 | Minus |
2L | 23513712 | 2L | 17410252..17410401 | 150..1 | 750 | 100 | Minus |
2L | 23513712 | 2L | 17409698..17409793 | 511..416 | 480 | 100 | Minus |
2L | 23513712 | 2L | 17410088..17410177 | 240..151 | 450 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 17409855..17410034 | 416..237 | 885 | 99.4 | Minus |
2L | 23513712 | 2L | 17410252..17410401 | 150..1 | 750 | 100 | Minus |
2L | 23513712 | 2L | 17409698..17409793 | 511..416 | 480 | 100 | Minus |
2L | 23513712 | 2L | 17410088..17410177 | 240..151 | 450 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\HeT-A | 5691 | Dyak\HeT-A YAKHETA 5691bp | 339..367 | 27..55 | 109 | 86.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 17408350..17408446 | 416..512 | 98 | <- | Minus |
chr2L | 17408509..17408683 | 241..415 | 100 | <- | Minus |
chr2L | 17408741..17408830 | 151..240 | 100 | <- | Minus |
chr2L | 17408905..17409054 | 1..150 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb11-RA | 1..354 | 98..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb11-RA | 1..354 | 98..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb11-RA | 1..354 | 98..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb11-RA | 1..478 | 34..512 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb11-RA | 6..516 | 1..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb11-RA | 6..516 | 1..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17409697..17409793 | 416..512 | 98 | <- | Minus |
2L | 17409856..17410030 | 241..415 | 100 | <- | Minus |
2L | 17410088..17410177 | 151..240 | 100 | <- | Minus |
2L | 17410252..17410401 | 1..150 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17409697..17409793 | 416..512 | 98 | <- | Minus |
2L | 17409856..17410030 | 241..415 | 100 | <- | Minus |
2L | 17410088..17410177 | 151..240 | 100 | <- | Minus |
2L | 17410252..17410401 | 1..150 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17409697..17409793 | 416..512 | 98 | <- | Minus |
2L | 17409856..17410030 | 241..415 | 100 | <- | Minus |
2L | 17410088..17410177 | 151..240 | 100 | <- | Minus |
2L | 17410252..17410401 | 1..150 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 17409856..17410030 | 241..415 | 100 | <- | Minus |
arm_2L | 17410088..17410177 | 151..240 | 100 | <- | Minus |
arm_2L | 17410252..17410401 | 1..150 | 100 | Minus | |
arm_2L | 17409697..17409793 | 416..512 | 98 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17410252..17410401 | 1..150 | 100 | Minus | |
2L | 17409697..17409793 | 416..512 | 98 | <- | Minus |
2L | 17409856..17410030 | 241..415 | 100 | <- | Minus |
2L | 17410088..17410177 | 151..240 | 100 | <- | Minus |
Translation from 97 to 450
> MIP32452.hyp MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQL LKDPNVLFAGYKVPHPLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSL FEERFKDAIKEKKEGGD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb11-PA | 117 | CG6840-PA | 1..117 | 1..117 | 602 | 100 | Plus |
Translation from 97 to 450
> MIP32452.pep MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQL LKDPNVLFAGYKVPHPLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSL FEERFKDAIKEKKEGGD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15107-PA | 117 | GF15107-PA | 1..117 | 1..117 | 611 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21750-PA | 117 | GG21750-PA | 1..117 | 1..117 | 611 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10081-PA | 117 | GH10081-PA | 1..117 | 1..117 | 611 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb11-PA | 117 | CG6840-PA | 1..117 | 1..117 | 602 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16585-PA | 117 | GI16585-PA | 1..117 | 1..117 | 611 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18757-PA | 117 | GL18757-PA | 1..117 | 1..117 | 606 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19897-PA | 117 | GA19897-PA | 1..117 | 1..117 | 606 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17133-PA | 105 | GM17133-PA | 1..105 | 1..105 | 531 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21874-PA | 117 | GD21874-PA | 1..117 | 1..117 | 611 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16235-PA | 117 | GJ16235-PA | 1..117 | 1..117 | 611 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24832-PA | 117 | GK24832-PA | 1..117 | 1..117 | 611 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13140-PA | 117 | GE13140-PA | 1..117 | 1..117 | 611 | 100 | Plus |