Clone MIP32452 Report

Search the DGRC for MIP32452

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:324
Well:52
Vector:pOTB7_DraIII
Associated Gene/TranscriptRpb11-RA
Protein status:MIP32452.pep: gold
Sequenced Size:534

Clone Sequence Records

MIP32452.complete Sequence

534 bp assembled on 2011-08-19

GenBank Submission: BT128818.1

> MIP32452.complete
AGTCAACACTGTACCGGAGAATTTTGCTGAGCGTGCTGCTGATTTTAATA
AACAATTTATAAGTTTTGCAGTAACTAACGAAAAGTAAGACATCAAAATG
AACGCACCACCTACCTTTGAGTCATTTCTGCTCTATGAAGGCGAGAAAAA
AATCATCAAGGAACTGGACACCAAAGTGACCAATGCGGCTATATTCACCA
TAAACAAAGAGGATCACACGCTGGGCAACATGATCCGCAACCAACTGCTG
AAGGATCCCAATGTTCTGTTTGCCGGCTACAAGGTTCCGCATCCTCTGGA
GCACAAGTTCGTCATCCGCATCCAGACTACGGCCGATTATTCTCCGCAGG
AAGCATTCATGAACGCCATAACCGATCTTCTAGCAGAATTATCTCTCTTC
GAAGAGCGTTTCAAAGACGCCATCAAGGAGAAGAAGGAGGGCGGCGATTA
ATCATATAATTACCAATTAATTCCTTAGTCTTATGAAAACCCAATAAAAG
CTTCTTCTTCCGAAAAAAAAAAAAAAAAAAAAAA

MIP32452.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17408508..17408687 416..237 885 99.4 Minus
chr2L 23010047 chr2L 17408905..17409054 150..1 750 100 Minus
chr2L 23010047 chr2L 17408351..17408446 511..416 480 100 Minus
chr2L 23010047 chr2L 17408741..17408830 240..151 450 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17409855..17410034 416..237 885 99.4 Minus
2L 23513712 2L 17410252..17410401 150..1 750 100 Minus
2L 23513712 2L 17409698..17409793 511..416 480 100 Minus
2L 23513712 2L 17410088..17410177 240..151 450 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17409855..17410034 416..237 885 99.4 Minus
2L 23513712 2L 17410252..17410401 150..1 750 100 Minus
2L 23513712 2L 17409698..17409793 511..416 480 100 Minus
2L 23513712 2L 17410088..17410177 240..151 450 100 Minus
Blast to na_te.dros performed 2019-03-15 10:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 339..367 27..55 109 86.2 Plus

MIP32452.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:14 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17408350..17408446 416..512 98 <- Minus
chr2L 17408509..17408683 241..415 100 <- Minus
chr2L 17408741..17408830 151..240 100 <- Minus
chr2L 17408905..17409054 1..150 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 13:27:08 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb11-RA 1..354 98..451 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:29:48 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb11-RA 1..354 98..451 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:14 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb11-RA 1..354 98..451 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 13:27:08 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb11-RA 1..478 34..512 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:29:48 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb11-RA 6..516 1..511 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:14 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb11-RA 6..516 1..511 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:14 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17409697..17409793 416..512 98 <- Minus
2L 17409856..17410030 241..415 100 <- Minus
2L 17410088..17410177 151..240 100 <- Minus
2L 17410252..17410401 1..150 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:14 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17409697..17409793 416..512 98 <- Minus
2L 17409856..17410030 241..415 100 <- Minus
2L 17410088..17410177 151..240 100 <- Minus
2L 17410252..17410401 1..150 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:14 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17409697..17409793 416..512 98 <- Minus
2L 17409856..17410030 241..415 100 <- Minus
2L 17410088..17410177 151..240 100 <- Minus
2L 17410252..17410401 1..150 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:29:48 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17409856..17410030 241..415 100 <- Minus
arm_2L 17410088..17410177 151..240 100 <- Minus
arm_2L 17410252..17410401 1..150 100   Minus
arm_2L 17409697..17409793 416..512 98 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:31 Download gff for MIP32452.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17410252..17410401 1..150 100   Minus
2L 17409697..17409793 416..512 98 <- Minus
2L 17409856..17410030 241..415 100 <- Minus
2L 17410088..17410177 151..240 100 <- Minus

MIP32452.hyp Sequence

Translation from 97 to 450

> MIP32452.hyp
MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQL
LKDPNVLFAGYKVPHPLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSL
FEERFKDAIKEKKEGGD*

MIP32452.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb11-PA 117 CG6840-PA 1..117 1..117 602 100 Plus

MIP32452.pep Sequence

Translation from 97 to 450

> MIP32452.pep
MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQL
LKDPNVLFAGYKVPHPLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSL
FEERFKDAIKEKKEGGD*

MIP32452.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15107-PA 117 GF15107-PA 1..117 1..117 611 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21750-PA 117 GG21750-PA 1..117 1..117 611 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10081-PA 117 GH10081-PA 1..117 1..117 611 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb11-PA 117 CG6840-PA 1..117 1..117 602 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16585-PA 117 GI16585-PA 1..117 1..117 611 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18757-PA 117 GL18757-PA 1..117 1..117 606 99.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19897-PA 117 GA19897-PA 1..117 1..117 606 99.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17133-PA 105 GM17133-PA 1..105 1..105 531 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21874-PA 117 GD21874-PA 1..117 1..117 611 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16235-PA 117 GJ16235-PA 1..117 1..117 611 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24832-PA 117 GK24832-PA 1..117 1..117 611 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13140-PA 117 GE13140-PA 1..117 1..117 611 100 Plus