Clone MIP32457 Report

Search the DGRC for MIP32457

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:324
Well:57
Vector:pOTB7_DraIII
Associated Gene/TranscriptGrx-1-RA
Protein status:MIP32457.pep: gold
Sequenced Size:546

Clone Sequence Records

MIP32457.complete Sequence

546 bp assembled on 2011-08-19

GenBank Submission: BT128810.1

> MIP32457.complete
GCCTTTCAAAAACATTCAGTCGAAAACGGTTGCTCAAAATTCCATAGCCT
CAAGCCTCGCTTCCCCCATTCCCGAACATTTTCGGATCAGAACATTCCAT
GGGTACGGTGGTCAGCACCCTGCAGCGACCCACTCTCTACGTGAGCATGG
ACAGCTCGCATGCGCAGTTCGTGCGGGACACAATCAGCGGCAACAAGGTG
GTGATCTTTAGCAAGAGCTACTGCCCCTACTGCAGCATGGCCAAGGAACA
GTTCCGAAAGATCAACGTCAAGGCAACGGTGATTGAGCTGGACCAGCGGG
ATGATGGCAACGAGATCCAGGCGGTTCTTGGCGAGATGACGGGCTCGAGG
ACCGTTCCACGTTGCTTCATCGATGGCAAGTTCGTGGGTGGCGGCACCGA
CGTGAAGCGGCTATACGAACAGGGCATACTGCAGAAGTATTTTCAGTGAA
AAGTGGGCCGACCTATGATCTTACATTTGCTTTTCTTGCTCTGCAGTAAT
AAAGATAGCAGTTTGGGACATAGAAAAAAAAAAAAAAAAAAAAAAA

MIP32457.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17643839..17644318 1..480 2325 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21757393..21757925 1..533 2620 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21758592..21759124 1..533 2620 99.4 Plus
Blast to na_te.dros performed on 2019-03-15 10:56:26 has no hits.

MIP32457.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:57:17 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17643839..17644318 1..480 98 == Plus
chr2R 17644319..17644346 495..523 96   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-19 13:56:05 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
Grx-1-RA 1..351 99..449 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:29:57 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
Grx-1-RA 1..351 99..449 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:16:17 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
Grx-1-RA 1..351 99..449 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-19 13:56:05 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
Grx-1-RA 1..488 35..523 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:29:57 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
Grx-1-RA 49..569 1..521 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:17 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
Grx-1-RA 49..569 1..521 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:17 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21757393..21757914 1..523 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:17 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21757393..21757914 1..523 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:57:17 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21757393..21757914 1..523 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:29:57 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17644898..17645419 1..523 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:34 Download gff for MIP32457.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21758592..21759113 1..523 99   Plus

MIP32457.hyp Sequence

Translation from 98 to 448

> MIP32457.hyp
MGTVVSTLQRPTLYVSMDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKE
QFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGT
DVKRLYEQGILQKYFQ*

MIP32457.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Grx-1-PA 116 CG7975-PA 1..116 1..116 599 100 Plus
CG6852-PC 114 CG6852-PC 1..114 1..116 415 68.1 Plus
CG6852-PA 114 CG6852-PA 1..114 1..116 415 68.1 Plus

MIP32457.pep Sequence

Translation from 98 to 448

> MIP32457.pep
MGTVVSTLQRPTLYVSMDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKE
QFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRCFIDGKFVGGGT
DVKRLYEQGILQKYFQ*

MIP32457.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13268-PA 116 GF13268-PA 1..116 1..116 522 81.9 Plus
Dana\GF23644-PA 100 GF23644-PA 1..100 17..116 409 72 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22140-PA 116 GG22140-PA 1..116 1..116 600 96.6 Plus
Dere\GG16009-PA 114 GG16009-PA 1..114 1..116 429 68.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21128-PA 116 GH21128-PA 1..116 1..116 495 78.4 Plus
Dgri\GH14597-PA 100 GH14597-PA 1..100 17..116 411 72 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Grx1t-PA 116 CG7975-PA 1..116 1..116 599 100 Plus
Grx1-PC 114 CG6852-PC 1..114 1..116 415 68.1 Plus
Grx1-PA 114 CG6852-PA 1..114 1..116 415 68.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18731-PA 116 GI18731-PA 1..116 1..116 513 75.9 Plus
Dmoj\GI13483-PA 100 GI13483-PA 1..100 17..116 405 73 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16951-PA 116 GL16951-PA 1..116 1..116 542 86.2 Plus
Dper\GL24885-PA 100 GL24885-PA 1..99 17..115 381 69.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20735-PA 116 GA20735-PA 1..116 1..116 542 86.2 Plus
Dpse\GA19906-PA 114 GA19906-PA 1..113 1..115 395 64.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15863-PA 116 GM15863-PA 1..115 1..115 595 96.5 Plus
Dsec\GM14998-PA 100 GM14998-PA 1..100 17..116 408 72 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11625-PA 116 GD11625-PA 1..115 1..115 595 96.5 Plus
Dsim\GD14776-PA 114 GD14776-PA 1..114 1..116 431 68.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21751-PA 116 GJ21751-PA 1..116 1..116 519 79.3 Plus
Dvir\GJ11844-PA 100 GJ11844-PA 1..100 17..116 421 74 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15655-PA 116 GK15655-PA 1..116 1..116 496 80.2 Plus
Dwil\GK20447-PA 111 GK20447-PA 1..111 1..116 411 66.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12221-PA 116 GE12221-PA 1..116 1..116 596 95.7 Plus
Dyak\GE23086-PA 114 GE23086-PA 1..114 1..116 431 68.1 Plus
Dyak\GE19570-PA 100 GE19570-PA 1..100 17..116 412 72 Plus