MIP34396.complete Sequence
424 bp assembled on 2012-01-16
GenBank Submission: BT133031.1
> MIP34396.complete
ATTTTCCAAGTATACCAACCGACGGGGGTGTACACATCACGTCAACGCCG
CAAATTGGTTCGTTCCGCTGCAAATTTTTCAGGCTCTAATATGTCACCTT
GGTCACAGCTGAAACCGATGGAGTGGTGTAAGGCCGTTTACAGGGACTAT
CATTCCTGGTCATTCGTCAAGTGTTCCCTGGCATTCTGTGCCGGTGTCCT
CCTGGTCCGAAGCCTCGATGGAAAGTTGCCGGCCAGCAGCTAGAAACCCG
AAATTTAGACCTATAACTAATTGAATATAGGATCATATTGCCAGTCATCT
AACCAAATTGTCGTCGACGAAGGAGCGAAAGAAATCAGGATGACTCAAAC
TGGTATATTCGTTTACTTGTTGACTTAAATAAAAATAAAACAACAAAAAT
TAAGTTCAAAAAAAAAAAAAAAAA
MIP34396.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:25:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chr2R | 21145070 | chr2R | 15524907..15525200 | 57..350 | 1470 | 100 | Plus |
| chr2R | 21145070 | chr2R | 15524783..15524841 | 1..59 | 295 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:25:20
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 19637683..19637976 | 57..350 | 1470 | 100 | Plus |
| 2R | 25286936 | 2R | 19637559..19637617 | 1..59 | 295 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 12:25:20 has no hits.
MIP34396.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:26:00 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chr2R | 15524783..15524839 | 1..57 | 100 | -> | Plus |
| chr2R | 15524908..15525265 | 58..407 | 94 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:58:39 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43277-RA | 1..153 | 91..243 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:59:09 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43277-RA | 1..153 | 91..243 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:58:39 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43277-RA | 1..415 | 1..407 | 95 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:59:09 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43277-RA | 1..415 | 1..407 | 95 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:26:00 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 19637684..19638041 | 58..407 | 94 | | Plus |
| 2R | 19637559..19637615 | 1..57 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:26:00 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 19637684..19638041 | 58..407 | 94 | | Plus |
| 2R | 19637559..19637615 | 1..57 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:26:00 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 19637684..19638041 | 58..407 | 94 | | Plus |
| 2R | 19637559..19637615 | 1..57 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:58:39 Download gff for
MIP34396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 15525064..15525120 | 1..57 | 100 | -> | Plus |
| arm_2R | 15525189..15525546 | 58..407 | 94 | | Plus |
MIP34396.hyp Sequence
Translation from 0 to 242
> MIP34396.hyp
IFQVYQPTGVYTSRQRRKLVRSAANFSGSNMSPWSQLKPMEWCKAVYRDY
HSWSFVKCSLAFCAGVLLVRSLDGKLPASS*
MIP34396.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:58:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43277-PA | 50 | CG43277-PA | 1..50 | 31..80 | 277 | 100 | Plus |
MIP34396.pep Sequence
Translation from 0 to 242
> MIP34396.pep
IFQVYQPTGVYTSRQRRKLVRSAANFSGSNMSPWSQLKPMEWCKAVYRDY
HSWSFVKCSLAFCAGVLLVRSLDGKLPASS*
MIP34396.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:39:15
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dana\GF11728-PA | 55 | GF11728-PA | 1..47 | 31..77 | 188 | 66 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43277-PA | 50 | CG43277-PA | 1..50 | 31..80 | 277 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:39:18
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM21975-PA | 50 | GM21975-PA | 1..50 | 31..80 | 235 | 92 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:39:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dyak\GE12068-PA | 50 | GE12068-PA | 1..50 | 31..80 | 250 | 94 | Plus |
