Clone Sequence Records
MIP34463.complete Sequence
414 bp assembled on 2012-01-20
GenBank Submission: BT133129.1
> MIP34463.complete
AGAAAAGAATGTCGTCTTTGGAGGGAACCGCACCTCCGTCGGAATTACCT
CCTTGCGCTGCAGGATTCACCTGGGTAATTCTAATGAGCACCTGCCTGCC
GGATTTGGCACGCACGAAAAGCCGATGTGTTTATGGATATTACTTTAACG
AAAAACTAAAAAAATGTATGCGCCGCAGATATGACAAGGAACAGAAGCCA
GGTGTTATAAGGCAGTGGATGAAGGCTACGACCAAGAAACCGACCACTGC
AAGAGGACCTTGTTTTCAACGCGAGCAAGCGTACACTGGCAACTGGTTTG
GCTACAATGCAGGATATGGAAGGAATGAAACGCGTCGTTAGTAAATGTTA
TGTTTATTGGATGCAGATAATTATGATGAATAAAATATTTTAATCCTAAA
AAAAAAAAAAAAAA
MIP34463.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:53:46
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chr2R | 21145070 | chr2R | 13142490..13142752 | 132..397 | 1190 | 97.4 | Plus |
| chr2R | 21145070 | chr2R | 13142304..13142434 | 1..131 | 595 | 96.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:53:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 17255443..17255705 | 132..397 | 1190 | 97.4 | Plus |
| 2R | 25286936 | 2R | 17255257..17255387 | 1..131 | 595 | 96.9 | Plus |
Blast to na_te.dros performed on 2019-03-15 12:53:44 has no hits.
MIP34463.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:54:45 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chr2R | 13142304..13142434 | 1..131 | 96 | -> | Plus |
| chr2R | 13142490..13142752 | 132..397 | 97 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:04:47 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43272-RA | 1..174 | 168..341 | 98 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:14:24 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43272-RA | 1..174 | 168..341 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:04:47 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43272-RB | 17..410 | 1..397 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:14:24 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43272-RB | 17..410 | 1..397 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:45 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 17255257..17255387 | 1..131 | 96 | -> | Plus |
| 2R | 17255443..17255705 | 132..397 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:45 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 17255257..17255387 | 1..131 | 96 | -> | Plus |
| 2R | 17255443..17255705 | 132..397 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:45 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 17255257..17255387 | 1..131 | 96 | -> | Plus |
| 2R | 17255443..17255705 | 132..397 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:04:47 Download gff for
MIP34463.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 13142762..13142892 | 1..131 | 96 | -> | Plus |
| arm_2R | 13142948..13143210 | 132..397 | 97 | | Plus |
MIP34463.hyp Sequence
Translation from 2 to 340
> MIP34463.hyp
KRMSSLEGTAPPSELPPCAAGFTWVILMSTCLPDLARTRSRCVYGYYFNE
KLKKCMRRRYDKEQKPGVIRQWMKATTKKPTTARGPCFQREQAYTGNWFG
YNAGYGRNETRR*
MIP34463.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2015-03-20 11:23:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43272-PB | 57 | CG43272-PB | 1..57 | 56..112 | 321 | 100 | Plus |
| CG43272-PA | 57 | CG43272-PA | 1..57 | 56..112 | 321 | 100 | Plus |
MIP34463.pep Sequence
Translation from 8 to 340
> MIP34463.pep
MSSLEGTAPPSELPPCAAGFTWVILMSTCLPDLARTKSRCVYGYYFNEKL
KKCMRRRYDKEQKPGVIRQWMKATTKKPTTARGPCFQREQAYTGNWFGYN
AGYGRNETRR*
MIP34463.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 01:26:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dana\GF11448-PA | 127 | GF11448-PA | 6..126 | 2..109 | 190 | 36.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43272-PB | 57 | CG43272-PB | 1..57 | 54..110 | 321 | 100 | Plus |
| CG43272-PA | 57 | CG43272-PA | 1..57 | 54..110 | 321 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 01:26:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dmoj\GI18618-PA | 161 | GI18618-PA | 47..158 | 16..107 | 148 | 29.5 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 01:26:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dper\GL17249-PA | 199 | GL17249-PA | 95..198 | 11..109 | 169 | 36.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 01:26:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dpse\GA25063-PA | 187 | GA25063-PA | 83..186 | 11..109 | 168 | 36.5 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 01:26:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\GJ21629-PA | 144 | GJ21629-PA | 47..141 | 16..107 | 171 | 37.5 | Plus |
