Clone MIP36958 Report

Search the DGRC for MIP36958

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:369
Well:58
Vector:pOT2
Associated Gene/TranscriptCG44476-RA
Protein status:MIP36958.pep: gold
Sequenced Size:310

Clone Sequence Records

MIP36958.complete Sequence

310 bp assembled on 2013-06-06

> MIP36958.complete
AAGCTGAAAAGATCAGAGTGCCTCCAAAAAAATGGGTGAAGAAAAAGATG
TCTTATTGGATAGAGATAGTTGCACCCTCAACGGAGTGGACCAAGAACAA
ACCGATGCGATTCATAACGACTCTAATATGGAAATATTAACTGAGGAAGA
CTCAAGGCCATATACTTTTTTGCAAAACTTTAATTTCGTTGGCTTATGTG
TTCTTTATAATTTTTGCATGCTTTTAATTGTTCTGTCCATATACATCTAC
AAACGATGGAATTAAAAAAGGGATTTTAAAATGAAAAAAAAAAAAAAAAA
AAAAAAAAAA

MIP36958.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18111481..18111728 283..36 1240 100 Minus
chr2L 23010047 chr2L 18111788..18111823 36..1 180 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18112823..18113071 284..36 1245 100 Minus
2L 23513712 2L 18113131..18113166 36..1 180 100 Minus
Blast to na_te.dros performed 2019-03-15 14:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1344..1391 231..184 105 68.8 Minus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6325..6352 218..245 104 85.7 Plus

MIP36958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:30:11 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18111481..18111727 37..283 100 <- Minus
chr2L 18111788..18111823 1..36 100   Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:30:31 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
CG44476-RA 1..234 32..265 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:59:48 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
CG44476-RA 1..234 32..265 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:30:31 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
CG44476-RA 14..290 1..277 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:59:48 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
CG44476-RA 14..290 1..277 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:11 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18112824..18113070 37..283 100 <- Minus
2L 18113131..18113166 1..36 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:11 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18112824..18113070 37..283 100 <- Minus
2L 18113131..18113166 1..36 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:11 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18112824..18113070 37..283 100 <- Minus
2L 18113131..18113166 1..36 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:30:31 Download gff for MIP36958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18112824..18113070 37..283 100 <- Minus
arm_2L 18113131..18113166 1..36 100   Minus

MIP36958.pep Sequence

Translation from 31 to 264

> MIP36958.pep
MGEEKDVLLDRDSCTLNGVDQEQTDAIHNDSNMEILTEEDSRPYTFLQNF
NFVGLCVLYNFCMLLIVLSIYIYKRWN*

MIP36958.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG44476-PA 77 CG44476-PA 1..77 1..77 412 100 Plus

MIP36958.hyp Sequence

Translation from 31 to 264

> MIP36958.hyp
MGEEKDVLLDRDSCTLNGVDQEQTDAIHNDSNMEILTEEDSRPYTFLQNF
NFVGLCVLYNFCMLLIVLSIYIYKRWN*

MIP36958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG44476-PA 77 CG44476-PA 1..77 1..77 412 100 Plus