Clone Sequence Records
MIP36958.complete Sequence
310 bp assembled on 2013-06-06
> MIP36958.complete
AAGCTGAAAAGATCAGAGTGCCTCCAAAAAAATGGGTGAAGAAAAAGATG
TCTTATTGGATAGAGATAGTTGCACCCTCAACGGAGTGGACCAAGAACAA
ACCGATGCGATTCATAACGACTCTAATATGGAAATATTAACTGAGGAAGA
CTCAAGGCCATATACTTTTTTGCAAAACTTTAATTTCGTTGGCTTATGTG
TTCTTTATAATTTTTGCATGCTTTTAATTGTTCTGTCCATATACATCTAC
AAACGATGGAATTAAAAAAGGGATTTTAAAATGAAAAAAAAAAAAAAAAA
AAAAAAAAAA
MIP36958.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:29:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 18111481..18111728 | 283..36 | 1240 | 100 | Minus |
chr2L | 23010047 | chr2L | 18111788..18111823 | 36..1 | 180 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:29:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18112823..18113071 | 284..36 | 1245 | 100 | Minus |
2L | 23513712 | 2L | 18113131..18113166 | 36..1 | 180 | 100 | Minus |
Blast to na_te.dros performed 2019-03-15 14:29:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 1344..1391 | 231..184 | 105 | 68.8 | Minus |
Quasimodo | 7387 | Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. | 6325..6352 | 218..245 | 104 | 85.7 | Plus |
MIP36958.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:30:11 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 18111481..18111727 | 37..283 | 100 | <- | Minus |
chr2L | 18111788..18111823 | 1..36 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:30:31 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44476-RA | 1..234 | 32..265 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:59:48 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44476-RA | 1..234 | 32..265 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:30:31 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44476-RA | 14..290 | 1..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:59:48 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44476-RA | 14..290 | 1..277 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:11 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18112824..18113070 | 37..283 | 100 | <- | Minus |
2L | 18113131..18113166 | 1..36 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:11 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18112824..18113070 | 37..283 | 100 | <- | Minus |
2L | 18113131..18113166 | 1..36 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:11 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18112824..18113070 | 37..283 | 100 | <- | Minus |
2L | 18113131..18113166 | 1..36 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:30:31 Download gff for
MIP36958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18112824..18113070 | 37..283 | 100 | <- | Minus |
arm_2L | 18113131..18113166 | 1..36 | 100 | | Minus |
MIP36958.pep Sequence
Translation from 31 to 264
> MIP36958.pep
MGEEKDVLLDRDSCTLNGVDQEQTDAIHNDSNMEILTEEDSRPYTFLQNF
NFVGLCVLYNFCMLLIVLSIYIYKRWN*
MIP36958.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44476-PA | 77 | CG44476-PA | 1..77 | 1..77 | 412 | 100 | Plus |
MIP36958.hyp Sequence
Translation from 31 to 264
> MIP36958.hyp
MGEEKDVLLDRDSCTLNGVDQEQTDAIHNDSNMEILTEEDSRPYTFLQNF
NFVGLCVLYNFCMLLIVLSIYIYKRWN*
MIP36958.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:54:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44476-PA | 77 | CG44476-PA | 1..77 | 1..77 | 412 | 100 | Plus |