Clone RE01035 Report

Search the DGRC for RE01035

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:10
Well:35
Vector:pFlc-1
Associated Gene/TranscriptRtnl1-RA
Protein status:RE01035.pep: gold
Sequenced Size:1432

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rtnl1-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE01035.complete Sequence

1432 bp assembled on 2009-08-10

GenBank Submission: BT099529.1

> RE01035.complete
AGTTCTTTTGCTGCGCTCGATTCAGACGGTCGGCCGAATCGTCCCATTCG
TGTGCCAGTGGTTGTGTGTGTGCGTGACTAGCCAACTAACTAACTTTATC
GCTGTAATTAAGCCTAGACACGCGAAAGTCCAGCCCGCTTTGCATACATT
TTGGCGCCAAGCTAACTGTTTTTAAAATACACAAAAAAATGGCAGGCGGC
AGCAAACGCTACTCACGCAACAACTCCAATGGCAATTTTCAGCCGCTTCC
AGAACGCGGACCAGTGGAATCCCTTATCTACTGGCGCGATGTGAAGAAAT
CCGGCATTGTCTTCGGCGCTGGCCTGATCACACTGGCGGCCATCTCCAGC
TTCTCGGTGATCAGCGTGTTCGCCTACTTGTCGCTCCTAACCCTCTTCGG
CACCGTCGCCTTCAGAATCTACAAATCTGTGACACAGGCCGTGCAAAAGA
CAAACGAGGGTCACCCCTTTAAGGATTACCTGGAGCTGGATCTGACGCTG
TCGCACGAAAAGGTACAGAACATTGCCGGCGTGGCTGTGGCACATATCAA
TGGCTTCATCTCCGAGCTGAGGCGTCTGTTTCTTGTTGAGGATATCATCG
ATTCGATCAAGTTCGGCGTCATTCTGTGGGTCTTCACCTACGTGGGTGCC
TGGTTCAATGGCATGACTCTGGTCATCTTGGCCTTTGTCTCGCTGTTTAC
CTTGCCCAAGGTCTACGAGAACAACAAGCAATCGATCGACACTCACTTGG
ATCTGGTGCGCAGCAAATTGACAGAAATCACCGACAAGATCCGAGTGGCC
ATCCCCATTGGCAACAAGAAGCCCGAGGCCGCTGCCGAGTCTGAGAAGGA
CAAGTAAAGAACCCGCACTAGCAAGAGAAACAACCACAAATAAACATGTT
TATTTATTTATTAAGCATTATTTGAATGGTTTTAATATTCATCCAGGCAT
TAAATAAATAACAAGTCTAGCAGCAATGTTTACATATTAATTGTATAATT
GCAATCAACATCAATCGATAATTGTAAATCAAATTTGAAGAGACCCAAAA
CAATTTATCAACCAACAACTCGTAGCAGTTTCAAACATTGTCCAAGTGTC
TTTAAGTTTTTAACGAACGAAACATTTAAAAAGCATATATAGTGAGGGAA
ATTAAGAAGAAAACGATTATATAGACGCAGCAATGCAAATAAATTTCTTA
TGAGTTCCACGCAATTTCCGATTTGAATCAACTATCTTCATTTCGATTTA
TTCAGCTTTCTTAGTTTTCATGTGACCCTTTTTAAATTAATTCTTTGCTT
TAGTTTTAGTTTTACTATTTTGTTGATTTTTTGTATAAAACAACAAGAAG
AACTAAGATTACTCTTAAAAACAAACAAACAAGAAAAAATCAAATAAAAA
ATGAAGTAAAAATCCACAAAAAAAAAAAAAAA

RE01035.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-RA 1692 Rtnl1-RA 57..1475 1..1419 7095 100 Plus
Rtnl1.f 2165 Rtnl1.f 13..1431 1..1419 7095 100 Plus
Rtnl1.j 2235 Rtnl1.j 345..1501 263..1419 5785 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4992748..4993377 1417..788 3150 100 Minus
chr2L 23010047 chr2L 4996214..4996477 264..1 1320 100 Minus
chr2L 23010047 chr2L 4993886..4994098 473..261 1065 100 Minus
chr2L 23010047 chr2L 4993608..4993816 681..473 1045 100 Minus
chr2L 23010047 chr2L 4993438..4993545 788..681 540 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4993646..4994277 1419..788 3160 100 Minus
2L 23513712 2L 4997114..4997377 264..1 1320 100 Minus
2L 23513712 2L 4994786..4994998 473..261 1065 100 Minus
2L 23513712 2L 4994508..4994716 681..473 1045 100 Minus
2L 23513712 2L 4994338..4994445 788..681 540 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4993646..4994277 1419..788 3160 100 Minus
2L 23513712 2L 4997114..4997377 264..1 1320 100 Minus
2L 23513712 2L 4994786..4994998 473..261 1065 100 Minus
2L 23513712 2L 4994508..4994716 681..473 1045 100 Minus
2L 23513712 2L 4994338..4994445 788..681 540 100 Minus
Blast to na_te.dros performed 2019-03-16 17:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 843..904 960..900 118 67.7 Minus
gypsy5 7369 gypsy5 GYPSY5 7369bp 5753..5844 1154..1247 114 62.5 Plus

RE01035.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:26:27 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4992748..4993377 788..1417 100 <- Minus
chr2L 4993439..4993544 682..787 100 <- Minus
chr2L 4993608..4993816 473..681 100 <- Minus
chr2L 4993887..4994094 265..472 100 <- Minus
chr2L 4996214..4996477 1..264 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:27 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RA 1..669 189..857 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:25 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RA 1..669 189..857 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:21 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RA 1..669 189..857 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:58:22 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RA 1..669 189..857 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-10 15:44:19 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RA 1..1397 21..1417 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:24 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RA 2..1418 1..1417 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:21 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RA 5..1421 1..1417 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:58:22 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RA 5..1421 1..1417 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:27 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4994787..4994994 265..472 100 <- Minus
2L 4994508..4994716 473..681 100 <- Minus
2L 4993648..4994277 788..1417 100 <- Minus
2L 4994339..4994444 682..787 100 <- Minus
2L 4997114..4997377 1..264 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:27 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4994787..4994994 265..472 100 <- Minus
2L 4994508..4994716 473..681 100 <- Minus
2L 4993648..4994277 788..1417 100 <- Minus
2L 4994339..4994444 682..787 100 <- Minus
2L 4997114..4997377 1..264 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:27 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4994787..4994994 265..472 100 <- Minus
2L 4994508..4994716 473..681 100 <- Minus
2L 4993648..4994277 788..1417 100 <- Minus
2L 4994339..4994444 682..787 100 <- Minus
2L 4997114..4997377 1..264 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:21 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4993648..4994277 788..1417 100 <- Minus
arm_2L 4994339..4994444 682..787 100 <- Minus
arm_2L 4994508..4994716 473..681 100 <- Minus
arm_2L 4994787..4994994 265..472 100 <- Minus
arm_2L 4997114..4997377 1..264 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:59 Download gff for RE01035.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4994787..4994994 265..472 100 <- Minus
2L 4997114..4997377 1..264 100   Minus
2L 4993648..4994277 788..1417 100 <- Minus
2L 4994339..4994444 682..787 100 <- Minus
2L 4994508..4994716 473..681 100 <- Minus

RE01035.pep Sequence

Translation from 188 to 856

> RE01035.pep
MAGGSKRYSRNNSNGNFQPLPERGPVESLIYWRDVKKSGIVFGAGLITLA
AISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLEL
DLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFT
YVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTEITDK
IRVAIPIGNKKPEAAAESEKDK*

RE01035.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14162-PA 596 GF14162-PA 394..596 21..222 944 90.2 Plus
Dana\GF17296-PA 259 GF17296-PA 6..185 19..191 262 33 Plus
Dana\GF10829-PA 294 GF10829-PA 20..193 11..188 234 34.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24328-PA 607 GG24328-PA 404..607 21..222 984 94.1 Plus
Dere\GG25105-PA 246 GG25105-PA 3..165 26..187 223 31.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11424-PA 234 GH11424-PA 24..234 12..222 919 84.4 Plus
Dgri\GH17123-PA 245 GH17123-PA 3..161 27..184 164 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-PA 222 CG33113-PA 1..222 1..222 1121 100 Plus
Rtnl1-PG 224 CG33113-PG 14..224 13..222 989 95.3 Plus
Rtnl1-PD 224 CG33113-PD 14..224 13..222 989 95.3 Plus
Rtnl1-PJ 234 CG33113-PJ 26..234 14..222 989 95.7 Plus
Rtnl1-PI 234 CG33113-PI 26..234 14..222 989 95.7 Plus
Rtnl1-PB 234 CG33113-PB 26..234 14..222 989 95.7 Plus
Rtnl1-PE 234 CG33113-PE 26..234 14..222 989 95.7 Plus
Rtnl1-PL 222 CG33113-PL 25..222 25..222 988 99.5 Plus
Rtnl1-PF 595 CG33113-PF 397..595 24..222 987 99.5 Plus
Rtnl1-PH 607 CG33113-PH 402..607 17..222 987 96.6 Plus
Rtnl1-PC 202 CG33113-PC 6..202 26..222 981 99.5 Plus
Rtnl2-PC 255 CG1279-PC 19..216 26..222 232 31.8 Plus
Rtnl2-PB 255 CG1279-PB 19..216 26..222 232 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14630-PA 234 GI14630-PA 24..234 12..222 955 87.7 Plus
Dmoj\GI11728-PA 258 GI11728-PA 13..175 27..188 263 33.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26483-PA 571 GL26483-PA 373..571 24..222 965 93 Plus
Dper\GL12168-PA 319 GL12168-PA 10..190 16..187 219 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28881-PA 224 GA28881-PA 16..224 15..222 969 89.5 Plus
Dpse\GA11813-PB 321 GA11813-PB 10..187 16..184 220 29.2 Plus
Dpse\GA11813-PA 298 GA11813-PA 3..164 26..184 215 29.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18049-PA 234 GM18049-PA 24..234 12..222 1014 94.3 Plus
Dsec\GM10472-PA 238 GM10472-PA 3..205 26..222 216 29.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22669-PA 234 GD22669-PA 24..234 12..222 1014 94.3 Plus
Dsim\GD19473-PA 238 GD19473-PA 3..205 26..222 224 30 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17140-PA 236 GJ17140-PA 24..234 12..222 938 85.8 Plus
Dvir\GJ11400-PA 265 GJ11400-PA 19..208 27..213 287 33.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24458-PA 587 GK24458-PA 382..585 21..222 951 90.2 Plus
Dwil\GK11074-PA 247 GK11074-PA 7..179 11..188 295 35.8 Plus
Dwil\GK19145-PA 159 GK19145-PA 9..156 16..163 137 24.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18708-PA 234 GE18708-PA 24..234 12..222 982 91 Plus
Dyak\GE25782-PA 264 GE25782-PA 19..224 26..222 241 30.8 Plus

RE01035.hyp Sequence

Translation from 188 to 856

> RE01035.hyp
MAGGSKRYSRNNSNGNFQPLPERGPVESLIYWRDVKKSGIVFGAGLITLA
AISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLEL
DLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFT
YVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTEITDK
IRVAIPIGNKKPEAAAESEKDK*

RE01035.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-PA 222 CG33113-PA 1..222 1..222 1121 100 Plus
Rtnl1-PG 224 CG33113-PG 14..224 13..222 989 95.3 Plus
Rtnl1-PD 224 CG33113-PD 14..224 13..222 989 95.3 Plus
Rtnl1-PJ 234 CG33113-PJ 26..234 14..222 989 95.7 Plus
Rtnl1-PL 222 CG33113-PL 25..222 25..222 988 99.5 Plus