Clone RE01054 Report

Search the DGRC for RE01054

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:10
Well:54
Vector:pFlc-1
Associated Gene/TranscriptOsi19-RB
Protein status:RE01054.pep: gold
Preliminary Size:801
Sequenced Size:1125

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15189 2002-01-01 Sim4 clustering to Release 2
CG15189 2003-01-01 Sim4 clustering to Release 3
CG15189 2004-07-26 Blastp of sequenced clone
Osi19 2008-04-29 Release 5.5 accounting
Osi19 2008-08-15 Release 5.9 accounting
Osi19 2008-12-18 5.12 accounting

Clone Sequence Records

RE01054.complete Sequence

1125 bp (1125 high quality bases) assembled on 2004-07-26

GenBank Submission: BT015241

> RE01054.complete
ATTAAACGCATTTGTGCCAGCGCAGAGGCCAGTTGTCCGTTGACCAGCGA
ACCTCGAATTAAAGAACTCGAACATCAAAATGGCCAAGTTGCTCCTTGTG
ATCGTTGGTGTGGCGGCCCTAGTGGCAGCGGGACAGGCGGCCGGTGGCTC
CACCGAAAAGATGCAGAGGCTTATCGCCGAGGAGCAAAACAAGTGCGCCA
GTGGCCAAGACTCGATGGCCTGCATCAAAGAGCGGGCCATGCGGTTTGTG
GACAACGTGATGAGCAAAGACAGCTTCCAGGTTTCCAACCTGGAAGTCCG
CTCCAATGGAGAGAAGACCACGCCTATCAACGAAGCTCGTGCCAGCAGTG
CCGACGGATTTCTGGACGCCATTGAGAACTATATCCGTGGACACGACGTG
AGCATGGACTTGCCCTTGGCCGATGCCAAGGTCACCGTCTCGGCCCGCAA
CCTGGTTAACAATCAGCTGAGCCTGAACCTCCAGCTGAACGGCGACGATG
GCGATGAGGGCACCGATGTCGAAGCCAGGGGCAAGAAACACCGTCTCCGC
AAGCTGGCCATGCCCATCCTGGTGCTCATCCTGCTGAAGGCCATCACAGT
GATCCCCATGGCCATTGGCATCCTGAAGATCAAGGCCTTCAACGCCCTGG
CCCTGGGCTTCTTCTCCTTCATTGTCTCGGTTGGTTTGGCCATTTTCCAA
TTGTGCAAAAAGATTGCTCATGATCACCATCACACCGCCCACATCACCGC
CCATGGTCCTTGGGACGGCCGCACCTTTAGCTCCGTTCCTGCCCCCGTTG
TCGAGCAGCCCCAGAAGTTGGGGCAAGCCCTGGCTTACCAGGCCTACGCT
TAGACCACAAGGATGAACCCCTGAGAGCCCAGAGGAGCAGTTTGGAGCCA
GCTAGTGGGCTCAAAAGCACAGAATCATTTGTTAACTGTTAGGAATATTC
GGTGACTTTGAGCCACTGTTTCACACTTCCAGTGCTGCCGCCCACTTCAT
TAGACTTTAATTATAATATTTATTAACTATTTATTGAAAACAAGACCTTA
AGCAAGCAGAGAAGCAAACACCAAAATAAAGTAGACAAATAAATGCCTTG
AATATGCCGAAAAAAAAAAAAAAAA

RE01054.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Osi19.b 1475 Osi19.b 204..1315 1..1112 5545 99.9 Plus
Osi19-RA 1374 Osi19-RA 791..1374 529..1112 2905 99.8 Plus
Osi19.a 1502 Osi19.a 759..1342 529..1112 2905 99.8 Plus
Osi19-RA 1374 Osi19-RA 236..772 1..537 2670 99.8 Plus
Osi19.a 1502 Osi19.a 204..740 1..537 2670 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2162474..2162870 711..1107 1985 100 Plus
chr3R 27901430 chr3R 2161040..2161321 1..282 1410 100 Plus
chr3R 27901430 chr3R 2161596..2161854 279..537 1280 99.6 Plus
chr3R 27901430 chr3R 2161955..2162137 530..712 915 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6336798..6337199 711..1112 1995 99.8 Plus
3R 32079331 3R 6335364..6335645 1..282 1410 100 Plus
3R 32079331 3R 6335920..6336178 279..537 1280 99.6 Plus
3R 32079331 3R 6336279..6336461 530..712 915 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6077629..6078030 711..1112 1995 99.7 Plus
3R 31820162 3R 6076195..6076476 1..282 1410 100 Plus
3R 31820162 3R 6076751..6077009 279..537 1280 99.6 Plus
3R 31820162 3R 6077110..6077292 530..712 915 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:35:26 has no hits.

RE01054.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:36:05 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2161956..2162137 531..712 100 -> Plus
chr3R 2161040..2161319 1..280 100 -> Plus
chr3R 2161598..2161847 281..530 100 -> Plus
chr3R 2162476..2162872 713..1109 92   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:33:44 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 1..774 80..853 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:26:28 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 1..774 80..853 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:17:36 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RA 478..801 531..853 99   Plus
Osi19-RA 1..451 80..530 100 -> Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:29:26 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 1..774 80..853 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:39:40 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RA 1..517 1..517 100 -> Plus
Osi19-RA 547..1136 518..1109 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:33:44 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 1..1109 1..1109 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:26:28 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 3..1111 1..1109 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:17:37 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RA 1..517 1..517 100 -> Plus
Osi19-RA 547..1136 518..1109 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:29:26 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 3..1111 1..1109 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:36:05 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6336800..6337196 713..1109 99   Plus
3R 6335364..6335643 1..280 100 -> Plus
3R 6335922..6336171 281..530 100 -> Plus
3R 6336280..6336461 531..712 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:36:05 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6336800..6337196 713..1109 99   Plus
3R 6335364..6335643 1..280 100 -> Plus
3R 6335922..6336171 281..530 100 -> Plus
3R 6336280..6336461 531..712 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:36:05 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6336800..6337196 713..1109 99   Plus
3R 6335364..6335643 1..280 100 -> Plus
3R 6335922..6336171 281..530 100 -> Plus
3R 6336280..6336461 531..712 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:26:28 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2161086..2161365 1..280 100 -> Plus
arm_3R 2161644..2161893 281..530 100 -> Plus
arm_3R 2162002..2162183 531..712 100 -> Plus
arm_3R 2162522..2162918 713..1109 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:54:43 Download gff for RE01054.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6077111..6077292 531..712 100 -> Plus
3R 6076195..6076474 1..280 100 -> Plus
3R 6076753..6077002 281..530 100 -> Plus
3R 6077631..6078027 713..1109 99   Plus

RE01054.pep Sequence

Translation from 79 to 852

> RE01054.pep
MAKLLLVIVGVAALVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIK
ERAMRFVDNVMSKDSFQVSNLEVRSNGEKTTPINEARASSADGFLDAIEN
YIRGHDVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDDGDEGTDVEAR
GKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAFNALALGFFSFIVS
VGLAIFQLCKKIAHDHHHTAHITAHGPWDGRTFSSVPAPVVEQPQKLGQA
LAYQAYA*

RE01054.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16392-PA 268 GF16392-PA 1..268 1..257 1079 86.2 Plus
Dana\GF16391-PA 307 GF16391-PA 7..228 6..225 151 24.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13302-PA 266 GG13302-PA 1..266 1..257 1166 92.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14036-PA 262 GH14036-PA 1..261 1..256 971 75.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Osi19-PB 257 CG15189-PB 1..257 1..257 1288 100 Plus
Osi19-PA 266 CG15189-PA 1..266 1..257 1268 96.6 Plus
Osi7-PA 288 CG1153-PA 29..243 17..225 199 26.5 Plus
Osi18-PA 306 CG1169-PA 8..227 7..225 178 25.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24409-PA 262 GI24409-PA 1..262 1..257 953 76 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24073-PA 273 GL24073-PA 1..272 1..256 1011 80.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13557-PA 273 GA13557-PA 1..272 1..256 1010 80.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10883-PA 266 GM10883-PA 1..265 1..256 1150 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19862-PA 266 GD19862-PA 1..265 1..256 1296 93.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14268-PA 266 GJ14268-PA 14..266 13..257 933 76.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13052-PA 266 GK13052-PA 21..266 22..257 956 79.4 Plus
Dwil\GK13051-PA 302 GK13051-PA 1..208 1..210 146 25.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10207-PA 266 GE10207-PA 1..265 1..256 1117 90.6 Plus

RE01054.hyp Sequence

Translation from 79 to 852

> RE01054.hyp
MAKLLLVIVGVAALVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIK
ERAMRFVDNVMSKDSFQVSNLEVRSNGEKTTPINEARASSADGFLDAIEN
YIRGHDVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDDGDEGTDVEAR
GKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAFNALALGFFSFIVS
VGLAIFQLCKKIAHDHHHTAHITAHGPWDGRTFSSVPAPVVEQPQKLGQA
LAYQAYA*

RE01054.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Osi19-PB 257 CG15189-PB 1..257 1..257 1288 100 Plus
Osi19-PA 266 CG15189-PA 1..266 1..257 1268 96.6 Plus
Osi7-PA 288 CG1153-PA 29..243 17..225 199 26.5 Plus
Osi18-PA 306 CG1169-PA 8..227 7..225 178 25.2 Plus