Clone RE01069 Report

Search the DGRC for RE01069

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:10
Well:69
Vector:pFlc-1
Associated Gene/TranscriptCHIP-RA
Protein status:RE01069.pep: gold
Preliminary Size:1239
Sequenced Size:1287

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5203 2001-11-29 Blastp of sequenced clone
CG5203 2002-01-01 Sim4 clustering to Release 2
CG5203 2003-01-01 Sim4 clustering to Release 3
CHIP 2008-04-29 Release 5.5 accounting
CHIP 2008-08-15 Release 5.9 accounting
CHIP 2008-12-18 5.12 accounting

Clone Sequence Records

RE01069.complete Sequence

1287 bp (1287 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069760

> RE01069.complete
GGTGAGTCTTGGCAACTCTAGAAACACATCGATTAACGTAGCTGAAAATT
GTTTTATGTTTAATTAAATACAGGCGAATAGCTCAAGATCTTTTTGGTGT
TATGAGCGTTCAAAAGTCACTACCGTTTCCCACTTAATACTTTGTTAACT
GTTAAGTTCGTGCAGCAGTTCCCCAATTCTTGCAGAGGAAACAAATTTAC
GAGTGCTTCGGTGTTGTTGGACACACACTCACTTTTCATCGGTGGAAAAT
CAAATTTGGGACCAGGCGCAGAAGATTCGTCAGGATGACGACCAAGCACA
TCTATTCCACGACCAATTTATCAGATCTGCAATTAAAGGAGCAGGGAAAC
TGCTTGTTTGCAGCCCGAAAATATGACGACGCAATAAATTGCTACTCAAA
GGCCATCATAAAGAACCCCACAAACGCCACATACTTCACAAACCGAGCCC
TCTGCAACCTGAAACTGAAGAGATGGGAACTGTGCTGCCAGGATAGTCGG
CGCGCCCTCGACATCGATGGGAATCTGTTGAAGGGTCACTTCTTCCTGGG
CCAAGGACTCATGGAAATCGACAACTTTGACGAGGCTATAAAGCACCTTC
AACGGGCATACGATCTGTCCAAGGAGCAGAAGCAAAACTTTGGGGATGAT
ATTACACTACAGTTGCGACTAGCTCGCAAAAAGCGCTGGAATGTTATGGA
GGAGAAGCGAATACAGCAGGAAATCGAGCTGCAAAGCTATTTAAATGGTC
TAATAAAAGGGGACATGGAAAGCCGTTTGGCCAATTTAAAGCTGAATGGA
AATGTACACGATGAGCAGCTGAAAGACAAGCAACAGGAAATTGAGCAAGA
ATGCGATGACCATATTAAGGAACTTAACAATATATTTTCTAAGGTTGACG
AACGTCGAAAGAAACGTGAAGTTCCCGATTTTCTATGTGGCAAAATAAGT
TTTGAAATATTAACAGACCCTGTGATAACTCCATCTGGAATTACGTATGA
ACGAAAAGATATAGAAGAACACTTGCAGCGGGTTGGACATTTCGATCCTG
TGACACGCGTTAAGCTCACTCAGGATCAACTAATACCAAATTTTTCAATG
AAGGAAGTGGTTGACTCTTTTATTGCCGAGAATGAATGGTCTTTAGATTA
TTAAGTTACTTATTAGTTGGCATTGTCATTGTAATTGATTAGATGTTAGA
ACCCAGTTCCCATTGTCTAAAAACCAGATAAGTGATAATAAATGTGGATC
TGCAATTGAGATTTATATTGCAAAAAAAAAAAAAAAA

RE01069.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
CHIP-RA 1432 CHIP-RA 123..1395 2..1274 6350 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10436391..10436796 2..407 2030 100 Plus
chr2L 23010047 chr2L 10437715..10438075 910..1270 1805 100 Plus
chr2L 23010047 chr2L 10436876..10437074 408..606 995 100 Plus
chr2L 23010047 chr2L 10437135..10437277 606..748 715 100 Plus
chr2L 23010047 chr2L 10437425..10437532 748..855 540 100 Plus
chr2L 23010047 chr2L 10437591..10437647 855..911 285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10437556..10437961 2..407 2030 100 Plus
2L 23513712 2L 10438880..10439244 910..1274 1810 99.7 Plus
2L 23513712 2L 10438041..10438239 408..606 995 100 Plus
2L 23513712 2L 10438300..10438442 606..748 715 100 Plus
2L 23513712 2L 10438590..10438697 748..855 540 100 Plus
2L 23513712 2L 10438756..10438812 855..911 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10437556..10437961 2..407 2030 100 Plus
2L 23513712 2L 10438880..10439244 910..1274 1810 99.7 Plus
2L 23513712 2L 10438041..10438239 408..606 995 100 Plus
2L 23513712 2L 10438300..10438442 606..748 715 100 Plus
2L 23513712 2L 10438590..10438697 748..855 540 100 Plus
2L 23513712 2L 10438756..10438812 855..911 285 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:25:02 has no hits.

RE01069.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:45 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10437136..10437277 607..748 100 -> Plus
chr2L 10437426..10437531 749..854 100 -> Plus
chr2L 10437591..10437647 855..911 100 -> Plus
chr2L 10436390..10436796 1..407 99 -> Plus
chr2L 10436876..10437074 408..606 100 -> Plus
chr2L 10437717..10438075 912..1271 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:22 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 1..870 285..1154 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:19:31 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 1..870 285..1154 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:57 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 1..870 285..1154 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:45:41 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 1..870 285..1154 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:50 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 1..870 285..1154 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:52:56 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 5..1274 1..1271 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:19:31 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 5..1274 1..1271 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:57 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 8..1277 1..1270 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:45:42 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 5..1274 1..1271 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:50 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
CHIP-RA 8..1277 1..1270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:45 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10437555..10437961 1..407 99 -> Plus
2L 10438041..10438239 408..606 100 -> Plus
2L 10438301..10438442 607..748 100 -> Plus
2L 10438591..10438696 749..854 100 -> Plus
2L 10438756..10438812 855..911 100 -> Plus
2L 10438882..10439240 912..1271 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:45 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10437555..10437961 1..407 99 -> Plus
2L 10438041..10438239 408..606 100 -> Plus
2L 10438301..10438442 607..748 100 -> Plus
2L 10438591..10438696 749..854 100 -> Plus
2L 10438756..10438812 855..911 100 -> Plus
2L 10438882..10439240 912..1271 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:45 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10437555..10437961 1..407 99 -> Plus
2L 10438041..10438239 408..606 100 -> Plus
2L 10438301..10438442 607..748 100 -> Plus
2L 10438591..10438696 749..854 100 -> Plus
2L 10438756..10438812 855..911 100 -> Plus
2L 10438882..10439240 912..1271 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:57 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10437555..10437961 1..407 99 -> Plus
arm_2L 10438041..10438239 408..606 100 -> Plus
arm_2L 10438301..10438442 607..748 100 -> Plus
arm_2L 10438591..10438696 749..854 100 -> Plus
arm_2L 10438756..10438812 855..911 100 -> Plus
arm_2L 10438882..10439240 912..1271 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:22:03 Download gff for RE01069.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10438756..10438812 855..911 100 -> Plus
2L 10438041..10438239 408..606 100 -> Plus
2L 10438301..10438442 607..748 100 -> Plus
2L 10438591..10438696 749..854 100 -> Plus
2L 10437555..10437961 1..407 99 -> Plus
2L 10438882..10439240 912..1271 99   Plus

RE01069.pep Sequence

Translation from 284 to 1153

> RE01069.pep
MTTKHIYSTTNLSDLQLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATY
FTNRALCNLKLKRWELCCQDSRRALDIDGNLLKGHFFLGQGLMEIDNFDE
AIKHLQRAYDLSKEQKQNFGDDITLQLRLARKKRWNVMEEKRIQQEIELQ
SYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQEIEQECDDHIKELNNI
FSKVDERRKKREVPDFLCGKISFEILTDPVITPSGITYERKDIEEHLQRV
GHFDPVTRVKLTQDQLIPNFSMKEVVDSFIAENEWSLDY*

RE01069.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15792-PA 289 GF15792-PA 1..289 1..289 1467 94.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23640-PA 289 GG23640-PA 1..289 1..289 1512 97.9 Plus
Dere\GG22948-PA 529 GG22948-PA 93..179 17..103 154 37.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13304-PA 289 GH13304-PA 1..289 1..289 1440 93.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
STUB1-PA 289 CG5203-PA 1..289 1..289 1519 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18167-PA 289 GI18167-PA 1..289 1..289 1380 92.7 Plus
Dmoj\GI14722-PA 411 GI14722-PA 130..225 16..111 152 34.4 Plus
Dmoj\GI22745-PA 515 GI22745-PA 46..136 16..106 148 34.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19010-PA 289 GL19010-PA 1..289 1..289 1446 92.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18734-PA 289 GA18734-PA 1..289 1..289 1446 92.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18427-PA 289 GM18427-PA 1..289 1..289 1515 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CHIP-PA 289 GD23704-PA 1..289 1..289 1522 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14605-PA 289 GJ14605-PA 1..289 1..289 1437 92.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15258-PA 289 GK15258-PA 1..289 1..289 1454 93.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\CHIP-PA 289 GE18461-PA 1..289 1..289 1493 97.2 Plus

RE01069.hyp Sequence

Translation from 284 to 1153

> RE01069.hyp
MTTKHIYSTTNLSDLQLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATY
FTNRALCNLKLKRWELCCQDSRRALDIDGNLLKGHFFLGQGLMEIDNFDE
AIKHLQRAYDLSKEQKQNFGDDITLQLRLARKKRWNVMEEKRIQQEIELQ
SYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQEIEQECDDHIKELNNI
FSKVDERRKKREVPDFLCGKISFEILTDPVITPSGITYERKDIEEHLQRV
GHFDPVTRVKLTQDQLIPNFSMKEVVDSFIAENEWSLDY*

RE01069.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
CHIP-PA 289 CG5203-PA 1..289 1..289 1519 100 Plus