Clone RE01079 Report

Search the DGRC for RE01079

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:10
Well:79
Vector:pFlc-1
Associated Gene/TranscriptRpS26-RA
Protein status:RE01079.pep: gold
Preliminary Size:591
Sequenced Size:665

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10305 2001-11-29 Blastp of sequenced clone
CG10305 2002-01-01 Sim4 clustering to Release 2
RpS26 2008-04-29 Release 5.5 accounting
RpS26 2008-08-15 Release 5.9 accounting
RpS26 2008-12-18 5.12 accounting

Clone Sequence Records

RE01079.complete Sequence

665 bp (665 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069761

> RE01079.complete
GTTCACACTATTTTCTTTCTTTTCGTTTCCCGAAACGTGAACACACGCGG
ATTTCGCTGGGCGGATTTTGAAATTGATAAATAAGCCGCCAAGATGACCA
AGAAGCGCCGTAACGGAGGACGCAACAAGCACAATCGCGGCCATGTGAAG
CCCGTGCGCTGCACCAACTGCGCCCGCTGCGTGCCCAAGGACAAGGCAAT
CAAGAAGTTCGTCATCCGCAACATCGTGGAGGCTGCCGCCGTGCGCGACA
TCACGGAGGCCAGCATCTGGGACTCGTACGTGCTGCCCAAGCTCTATGCG
AAGCTCCACTACTGCGTGTCCTGCGCAATCCACTCCAAGGTGGTGCGCAA
CCGTTCGCGCGAGGCCCGCCGCATCCGCACGCCGCCACTGCGTTCCTTCC
CCAAGGACATGGCCCGCAACAACCAGAACAGGAAGTAGAGGTCTCGTCCA
GCCGGAGGAGAGGAGCACTGGGTGCACCACCTGACATCTCCATATGGAGT
CTACCAATCTAGCCGGACTCGCGCCCCAGTGCGTTCCGCTCTGGCGTCGA
GGAATCGCCAAGATAAGTAGACGAAATATATGCATCCAGTTCTTTTTTAA
TTTCAAATAAACAGCGTGCTTCATTGGGAAACAGCTACTACCTACAAACA
AAAAAAAAAAAAAAA

RE01079.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
RpS26-RA 1078 RpS26-RA 250..897 4..651 3225 99.8 Plus
RpS26.b 1186 RpS26.b 88..735 4..651 3225 99.8 Plus
RpS26.a 723 RpS26.a 4..654 4..651 3170 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18441207..18441772 649..84 2800 99.6 Minus
chr2L 23010047 chr2L 18441854..18441935 85..4 395 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18442505..18443072 651..84 2825 99.8 Minus
2L 23513712 2L 18443153..18443234 85..4 410 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18442505..18443072 651..84 2825 99.8 Minus
2L 23513712 2L 18443153..18443234 85..4 410 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:30:27 has no hits.

RE01079.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:31:31 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18441207..18441770 86..649 99 <- Minus
chr2L 18441854..18441938 1..85 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:24 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RC 1..345 94..438 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:19:32 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RA 1..345 94..438 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:28:43 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RC 1..345 94..438 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:45:42 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RC 1..345 94..438 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:47 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RA 1..345 94..438 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:52:58 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RA 1..649 1..649 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:19:32 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RA 1..649 1..649 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:28:43 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RC 1..640 10..649 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:45:43 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RA 1..649 1..649 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:47 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
RpS26-RA 1..640 10..649 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:31 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18442507..18443070 86..649 99 <- Minus
2L 18443153..18443237 1..85 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:31 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18442507..18443070 86..649 99 <- Minus
2L 18443153..18443237 1..85 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:31:31 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18442507..18443070 86..649 99 <- Minus
2L 18443153..18443237 1..85 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:28:43 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18442507..18443070 86..649 99 <- Minus
arm_2L 18443153..18443237 1..85 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:22:04 Download gff for RE01079.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18442507..18443070 86..649 99 <- Minus
2L 18443153..18443237 1..85 98   Minus

RE01079.pep Sequence

Translation from 93 to 437

> RE01079.pep
MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAV
RDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR
SFPKDMARNNQNRK*

RE01079.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14848-PA 114 GF14848-PA 1..114 1..114 579 97.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21710-PA 114 GG21710-PA 1..114 1..114 591 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10536-PA 115 GH10536-PA 1..115 1..114 565 95.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpS26-PD 114 CG10305-PD 1..114 1..114 607 100 Plus
RpS26-PE 114 CG10305-PE 1..114 1..114 607 100 Plus
RpS26-PA 114 CG10305-PA 1..114 1..114 607 100 Plus
RpS26-PC 114 CG10305-PC 1..114 1..114 607 100 Plus
RpS26-PB 114 CG10305-PB 1..114 1..114 607 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17205-PA 114 GI17205-PA 1..114 1..114 581 97.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19426-PA 114 GL19426-PA 1..114 1..114 591 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10233-PA 114 GA10233-PA 1..114 1..114 591 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17090-PA 114 GM17090-PA 1..114 1..114 591 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21834-PA 114 GD21834-PA 1..114 1..114 591 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19840-PA 114 GJ19840-PA 1..114 1..114 581 97.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14573-PA 114 GK14573-PA 1..114 1..114 588 99.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS26-PA 114 GE12733-PA 1..114 1..114 591 100 Plus

RE01079.hyp Sequence

Translation from 93 to 437

> RE01079.hyp
MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAV
RDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR
SFPKDMARNNQNRK*

RE01079.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
RpS26-PD 114 CG10305-PD 1..114 1..114 607 100 Plus
RpS26-PE 114 CG10305-PE 1..114 1..114 607 100 Plus
RpS26-PA 114 CG10305-PA 1..114 1..114 607 100 Plus
RpS26-PC 114 CG10305-PC 1..114 1..114 607 100 Plus
RpS26-PB 114 CG10305-PB 1..114 1..114 607 100 Plus