BDGP Sequence Production Resources |
Search the DGRC for RE01079
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 10 |
Well: | 79 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS26-RA |
Protein status: | RE01079.pep: gold |
Preliminary Size: | 591 |
Sequenced Size: | 665 |
Gene | Date | Evidence |
---|---|---|
CG10305 | 2001-11-29 | Blastp of sequenced clone |
CG10305 | 2002-01-01 | Sim4 clustering to Release 2 |
RpS26 | 2008-04-29 | Release 5.5 accounting |
RpS26 | 2008-08-15 | Release 5.9 accounting |
RpS26 | 2008-12-18 | 5.12 accounting |
665 bp (665 high quality bases) assembled on 2001-11-29
GenBank Submission: AY069761
> RE01079.complete GTTCACACTATTTTCTTTCTTTTCGTTTCCCGAAACGTGAACACACGCGG ATTTCGCTGGGCGGATTTTGAAATTGATAAATAAGCCGCCAAGATGACCA AGAAGCGCCGTAACGGAGGACGCAACAAGCACAATCGCGGCCATGTGAAG CCCGTGCGCTGCACCAACTGCGCCCGCTGCGTGCCCAAGGACAAGGCAAT CAAGAAGTTCGTCATCCGCAACATCGTGGAGGCTGCCGCCGTGCGCGACA TCACGGAGGCCAGCATCTGGGACTCGTACGTGCTGCCCAAGCTCTATGCG AAGCTCCACTACTGCGTGTCCTGCGCAATCCACTCCAAGGTGGTGCGCAA CCGTTCGCGCGAGGCCCGCCGCATCCGCACGCCGCCACTGCGTTCCTTCC CCAAGGACATGGCCCGCAACAACCAGAACAGGAAGTAGAGGTCTCGTCCA GCCGGAGGAGAGGAGCACTGGGTGCACCACCTGACATCTCCATATGGAGT CTACCAATCTAGCCGGACTCGCGCCCCAGTGCGTTCCGCTCTGGCGTCGA GGAATCGCCAAGATAAGTAGACGAAATATATGCATCCAGTTCTTTTTTAA TTTCAAATAAACAGCGTGCTTCATTGGGAAACAGCTACTACCTACAAACA AAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 18441207..18441770 | 86..649 | 99 | <- | Minus |
chr2L | 18441854..18441938 | 1..85 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RC | 1..345 | 94..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RA | 1..345 | 94..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RC | 1..345 | 94..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RC | 1..345 | 94..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RA | 1..345 | 94..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RA | 1..649 | 1..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RA | 1..649 | 1..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RC | 1..640 | 10..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RA | 1..649 | 1..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS26-RA | 1..640 | 10..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18442507..18443070 | 86..649 | 99 | <- | Minus |
2L | 18443153..18443237 | 1..85 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18442507..18443070 | 86..649 | 99 | <- | Minus |
2L | 18443153..18443237 | 1..85 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18442507..18443070 | 86..649 | 99 | <- | Minus |
2L | 18443153..18443237 | 1..85 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 18442507..18443070 | 86..649 | 99 | <- | Minus |
arm_2L | 18443153..18443237 | 1..85 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18442507..18443070 | 86..649 | 99 | <- | Minus |
2L | 18443153..18443237 | 1..85 | 98 | Minus |
Translation from 93 to 437
> RE01079.pep MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAV RDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR SFPKDMARNNQNRK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14848-PA | 114 | GF14848-PA | 1..114 | 1..114 | 579 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21710-PA | 114 | GG21710-PA | 1..114 | 1..114 | 591 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10536-PA | 115 | GH10536-PA | 1..115 | 1..114 | 565 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS26-PD | 114 | CG10305-PD | 1..114 | 1..114 | 607 | 100 | Plus |
RpS26-PE | 114 | CG10305-PE | 1..114 | 1..114 | 607 | 100 | Plus |
RpS26-PA | 114 | CG10305-PA | 1..114 | 1..114 | 607 | 100 | Plus |
RpS26-PC | 114 | CG10305-PC | 1..114 | 1..114 | 607 | 100 | Plus |
RpS26-PB | 114 | CG10305-PB | 1..114 | 1..114 | 607 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17205-PA | 114 | GI17205-PA | 1..114 | 1..114 | 581 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19426-PA | 114 | GL19426-PA | 1..114 | 1..114 | 591 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10233-PA | 114 | GA10233-PA | 1..114 | 1..114 | 591 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17090-PA | 114 | GM17090-PA | 1..114 | 1..114 | 591 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21834-PA | 114 | GD21834-PA | 1..114 | 1..114 | 591 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19840-PA | 114 | GJ19840-PA | 1..114 | 1..114 | 581 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14573-PA | 114 | GK14573-PA | 1..114 | 1..114 | 588 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpS26-PA | 114 | GE12733-PA | 1..114 | 1..114 | 591 | 100 | Plus |
Translation from 93 to 437
> RE01079.hyp MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAV RDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR SFPKDMARNNQNRK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS26-PD | 114 | CG10305-PD | 1..114 | 1..114 | 607 | 100 | Plus |
RpS26-PE | 114 | CG10305-PE | 1..114 | 1..114 | 607 | 100 | Plus |
RpS26-PA | 114 | CG10305-PA | 1..114 | 1..114 | 607 | 100 | Plus |
RpS26-PC | 114 | CG10305-PC | 1..114 | 1..114 | 607 | 100 | Plus |
RpS26-PB | 114 | CG10305-PB | 1..114 | 1..114 | 607 | 100 | Plus |