Clone RE01312 Report

Search the DGRC for RE01312

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:13
Well:12
Vector:pFlc-1
Associated Gene/TranscriptTsp42Ef-RA
Protein status:RE01312.pep: gold
Preliminary Size:669
Sequenced Size:1362

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12845 2001-12-14 Blastp of sequenced clone
CG12845 2002-01-01 Sim4 clustering to Release 2
CG12845 2003-01-01 Sim4 clustering to Release 3
Tsp42Ef 2008-04-29 Release 5.5 accounting
Tsp42Ef 2008-08-15 Release 5.9 accounting
Tsp42Ef 2008-12-18 5.12 accounting

Clone Sequence Records

RE01312.complete Sequence

1362 bp (1362 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070898

> RE01312.complete
AGTGGATTTCTAGCCGACGGACAGACCGCACCTGATCCGAGTCATTCGCC
CATGAGTCATTCAACTCGCTGCGGGAAAGTGCCTCGCTGATTCCGACAAT
TTCCCACCATTGGTGGTGCTACGTTGCACGCTGTTAGATTGAGGAAATTC
GACATAGTTGCGACGATCTTCCAGAAAGTATCGATAACGTACAGGGAGCC
CAGAGAGAGATAGAGAGATATAGAAACATCGCTGATCTCACTGATCCGAT
TCGATCTCAAAGAGAGCGGAGGAGTACGAAAACAAGTTTCGCGCAGCTTG
CTCTCTCTTCAGGCGGCTCTCCAGGAATTTCAGGCATCTCGACCCCCAAC
GAATCCGAGGAGCATCATCCGCCATGGCGTCCACGTCGAGTGTGAAGCTG
ATTGTTTACGCCCTGGACGTACTTTGCACACTGCTAGCCTTGGTGCTGAT
ATCCTTCGGCATCTATGTGGCGGTGTCCTACAACCTAAACGAGATCGGTC
AGCTGACGGCCTACGGCTACGTGGGACTCGGGGCTGCTGCCCTGCTGGTT
GTCCTTTGGGGATACCTGTCCGCCTGGCGCGAGAACGTGTGCTGCACAGT
GACGTTCATTATTTTCCTGTGCCTGGTCATCATTGCCCAGTTCGCCGTCG
TCTACTTGCTGATCACCCAGGAGAAGACGGTGGCCTCCAACCTGGCTAAT
GCCCTGGAGGCCACCTGGGAGGAGGAACTGAACAGCCCTGGTGCCATGTC
GCTGTACCAGAACTGGTTCCAGTGCTGCGGTCGTGGAAGTCCCCAGGATT
ACATCGTCAACGAACGACTGCCGCCGGAGACATGTTTCCGAAACCACGAC
AAGAGCAAGCCGGAGAACCTGATCCACACCGGCTGTCGGGTGGAGTTCGA
GAACTACTGGCAACACTTGACCAAGATTTTTAACATCCTGGCCCTCGTAC
TCATTGGCTTCGAGCTCCTGCTGAGTGTCATCTCTTGCCGCCTGTGCAAC
AGCATTCGCAACGATGCTCGACGTTCTTACTTTTAGACAGTGAAACCTGA
AAATACTCAACTGGGATTGGCAGTCGACTTGTTAAATTTCTGAAGAATAT
TACACTATTAATTAATTGGCTTGGCAGGTCTTGAGCGTTATTCAAGACTG
GGGTATTGCTGTTATATTTTCGAAATTGAAACTCATTTAATCAGCACAGT
GCACTGAAATGATCCCTTTTCACACGTTGATTTCAGTGAAATACAGAGGG
CAACTCACAACTAAGATTAAGAAAAGTAAAATAGATTTAGTTTTATTTAT
TTCAACATACTTTTAAATAAATTTATCGAACCAAAGTCAAGCACCGAAAA
AAAAAAAAAAAA

RE01312.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Ef-RA 1593 Tsp42Ef-RA 114..1458 1..1345 6710 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2912432..2912861 1..430 2135 99.8 Plus
chr2R 21145070 chr2R 2915111..2915493 963..1345 1915 100 Plus
chr2R 21145070 chr2R 2914854..2915052 766..964 995 100 Plus
chr2R 21145070 chr2R 2914395..2914568 431..604 870 100 Plus
chr2R 21145070 chr2R 2914629..2914791 604..766 815 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7025012..7025441 1..430 2135 99.8 Plus
2R 25286936 2R 7027700..7028082 963..1345 1915 100 Plus
2R 25286936 2R 7027443..7027641 766..964 995 100 Plus
2R 25286936 2R 7026984..7027157 431..604 870 100 Plus
2R 25286936 2R 7027218..7027380 604..766 815 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7026211..7026640 1..430 2135 99.7 Plus
2R 25260384 2R 7028899..7029281 963..1345 1915 100 Plus
2R 25260384 2R 7028642..7028840 766..964 995 100 Plus
2R 25260384 2R 7028183..7028356 431..604 870 100 Plus
2R 25260384 2R 7028417..7028579 604..766 815 100 Plus
Blast to na_te.dros performed 2019-03-16 03:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Galileo 2304 Dbuz\Galileo GALILEO 2304bp 1115..1176 1263..1322 115 69.4 Plus

RE01312.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:03:31 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2914630..2914791 605..766 100 -> Plus
chr2R 2914855..2915052 767..964 100 -> Plus
chr2R 2914395..2914568 431..604 100 -> Plus
chr2R 2912432..2912861 1..430 99 -> Plus
chr2R 2915113..2915493 965..1346 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:29 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 1..663 374..1036 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:02:19 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 1..663 374..1036 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:41:51 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 1..663 374..1036 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:48 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 1..663 374..1036 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:28:56 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 1..663 374..1036 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:29:03 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 1..1345 1..1345 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:02:19 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 1..1345 1..1345 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:41:51 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 3..1347 1..1345 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:48 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 1..1345 1..1345 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:28:56 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ef-RA 3..1347 1..1345 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:31 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7025012..7025441 1..430 99 -> Plus
2R 7026984..7027157 431..604 100 -> Plus
2R 7027219..7027380 605..766 100 -> Plus
2R 7027444..7027641 767..964 100 -> Plus
2R 7027702..7028082 965..1346 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:31 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7025012..7025441 1..430 99 -> Plus
2R 7026984..7027157 431..604 100 -> Plus
2R 7027219..7027380 605..766 100 -> Plus
2R 7027444..7027641 767..964 100 -> Plus
2R 7027702..7028082 965..1346 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:31 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7025012..7025441 1..430 99 -> Plus
2R 7026984..7027157 431..604 100 -> Plus
2R 7027219..7027380 605..766 100 -> Plus
2R 7027444..7027641 767..964 100 -> Plus
2R 7027702..7028082 965..1346 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:41:51 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2914724..2914885 605..766 100 -> Plus
arm_2R 2914949..2915146 767..964 100 -> Plus
arm_2R 2912517..2912946 1..430 99 -> Plus
arm_2R 2914489..2914662 431..604 100 -> Plus
arm_2R 2915207..2915587 965..1346 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:39 Download gff for RE01312.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7026211..7026640 1..430 99 -> Plus
2R 7028183..7028356 431..604 100 -> Plus
2R 7028418..7028579 605..766 100 -> Plus
2R 7028643..7028840 767..964 100 -> Plus
2R 7028901..7029281 965..1346 99   Plus

RE01312.pep Sequence

Translation from 373 to 1035

> RE01312.pep
MASTSSVKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYV
GLGAAALLVVLWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQE
KTVASNLANALEATWEEELNSPGAMSLYQNWFQCCGRGSPQDYIVNERLP
PETCFRNHDKSKPENLIHTGCRVEFENYWQHLTKIFNILALVLIGFELLL
SVISCRLCNSIRNDARRSYF*

RE01312.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12683-PA 220 GF12683-PA 1..220 1..220 946 78.2 Plus
Dana\GF12685-PA 229 GF12685-PA 4..227 3..220 253 26.8 Plus
Dana\GF13154-PA 226 GF13154-PA 6..224 5..218 253 27.7 Plus
Dana\GF12682-PA 227 GF12682-PA 4..225 3..218 236 27.7 Plus
Dana\GF12686-PA 228 GF12686-PA 4..223 3..218 236 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23244-PA 220 GG23244-PA 1..220 1..220 1058 89.1 Plus
Dere\GG23246-PA 231 GG23246-PA 4..229 6..220 253 27.9 Plus
Dere\GG23247-PA 229 GG23247-PA 4..224 3..218 250 27.8 Plus
Dere\GG23240-PA 226 GG23240-PA 6..226 5..220 239 27.9 Plus
Dere\GG23245-PA 217 GG23245-PA 4..214 3..220 195 28.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21500-PA 219 GH21500-PA 1..219 1..220 848 70.5 Plus
Dgri\GH21494-PA 226 GH21494-PA 6..224 5..218 254 28.2 Plus
Dgri\GH21499-PA 230 GH21499-PA 4..230 3..220 223 27.2 Plus
Dgri\GH21502-PA 229 GH21502-PA 4..227 3..220 213 26.8 Plus
Dgri\GH21512-PA 218 GH21512-PA 4..218 3..220 203 27.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Ef-PA 220 CG12845-PA 1..220 1..220 1150 100 Plus
Tsp42Ei-PB 229 CG12843-PB 6..224 5..218 266 29 Plus
Tsp42Ei-PA 229 CG12843-PA 6..224 5..218 266 29 Plus
Tsp42Ea-PC 226 CG18817-PC 6..226 5..220 257 27.9 Plus
Tsp42Ea-PB 226 CG18817-PB 6..226 5..220 257 27.9 Plus
Tsp42Ea-PA 226 CG18817-PA 6..226 5..220 257 27.9 Plus
Tsp42Eh-PB 231 CG12844-PB 4..229 3..220 252 26.5 Plus
Tsp42Eg-PA 218 CG12142-PA 4..215 3..220 240 27.8 Plus
Tsp42Ee-PB 228 CG10106-PB 5..228 4..220 225 26.5 Plus
Tsp42Ee-PA 228 CG10106-PA 5..228 4..220 225 26.5 Plus
CG30160-PA 222 CG30160-PA 11..220 17..212 197 27.6 Plus
Tsp42Eb-PB 222 CG18816-PB 11..220 17..212 197 27.6 Plus
Tsp42Ed-PB 227 CG12846-PB 8..227 7..220 192 22 Plus
Tsp42Ed-PA 227 CG12846-PA 8..227 7..220 192 22 Plus
Tsp42Ek-PB 215 CG12841-PB 4..212 3..217 189 25.9 Plus
Tsp42Ek-PA 215 CG12841-PA 4..212 3..217 189 25.9 Plus
Tsp42El-PA 217 CG12840-PA 4..214 3..217 186 23.4 Plus
lbm-PB 208 CG2374-PB 4..208 3..220 182 27.9 Plus
lbm-PA 208 CG2374-PA 4..208 3..220 182 27.9 Plus
Tsp42Eq-PA 219 CG12832-PA 5..218 4..220 178 21.2 Plus
Tsp42Er-PA 211 CG12837-PA 8..211 7..220 158 21.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19470-PA 220 GI19470-PA 1..220 1..220 828 73.2 Plus
Dmoj\GI19464-PA 226 GI19464-PA 6..224 5..218 255 28.2 Plus
Dmoj\GI19472-PA 227 GI19472-PA 4..225 3..220 244 26.9 Plus
Dmoj\GI19473-PA 226 GI19473-PA 4..221 3..218 215 27.5 Plus
Dmoj\GI19477-PA 208 GI19477-PA 4..208 3..220 214 30.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11139-PA 220 GL11139-PA 1..220 1..220 921 77.3 Plus
Dper\GL11133-PA 226 GL11133-PA 6..224 5..218 261 28.2 Plus
Dper\GL11142-PA 228 GL11142-PA 4..223 3..218 246 27.9 Plus
Dper\GL11138-PA 252 GL11138-PA 83..252 50..220 242 31.6 Plus
Dper\GL11147-PA 208 GL11147-PA 4..208 3..220 196 28.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11850-PA 220 GA11850-PA 1..220 1..220 921 77.3 Plus
Dpse\GA15095-PA 226 GA15095-PA 6..224 5..218 261 28.2 Plus
Dpse\GA10076-PA 228 GA10076-PA 4..228 3..220 256 28.8 Plus
Dpse\GA24622-PA 228 GA24622-PA 4..223 3..218 246 27.9 Plus
Dpse\GA11849-PA 231 GA11849-PA 4..229 3..220 206 25.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20916-PA 220 GM20916-PA 1..220 1..220 1137 98.2 Plus
Dsec\GM20919-PA 229 GM20919-PA 4..224 3..218 255 28.7 Plus
Dsec\GM20918-PA 231 GM20918-PA 4..229 3..220 238 25.7 Plus
Dsec\GM20912-PA 226 GM20912-PA 6..226 5..220 235 26.1 Plus
Dsec\GM16190-PA 228 GM16190-PA 4..228 3..220 195 26.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10445-PA 225 GD10445-PA 1..225 1..220 1115 95.1 Plus
Dsim\GD10448-PA 229 GD10448-PA 4..224 3..218 253 27.6 Plus
Dsim\GD10441-PA 226 GD10441-PA 6..226 5..220 241 26.6 Plus
Dsim\GD10444-PA 228 GD10444-PA 4..228 3..220 196 26.7 Plus
Dsim\GD10446-PA 218 GD10446-PA 4..215 3..220 185 27.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15130-PA 220 GJ15130-PA 1..220 1..220 826 71.8 Plus
Dvir\GJ15124-PA 226 GJ15124-PA 6..224 5..218 259 28.6 Plus
Dvir\GJ15134-PA 226 GJ15134-PA 4..221 3..218 228 25.7 Plus
Dvir\GJ15133-PA 229 GJ15133-PA 4..227 3..220 211 27.2 Plus
Dvir\GJ15138-PA 208 GJ15138-PA 4..208 6..220 205 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21777-PA 220 GK21777-PA 1..220 1..220 813 65.9 Plus
Dwil\GK21771-PA 226 GK21771-PA 6..224 5..218 250 26.8 Plus
Dwil\GK21776-PA 228 GK21776-PA 4..228 3..220 218 27.2 Plus
Dwil\GK21780-PA 228 GK21780-PA 5..223 4..218 214 26.7 Plus
Dwil\GK21783-PA 217 GK21783-PA 4..214 3..217 210 26.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19095-PA 220 GE19095-PA 1..220 1..220 1077 90.9 Plus
Dyak\GE19098-PA 229 GE19098-PA 4..224 3..218 255 28.7 Plus
Dyak\GE19090-PA 226 GE19090-PA 6..226 5..220 246 27.5 Plus
Dyak\GE19097-PA 223 GE19097-PA 4..221 6..220 210 26.1 Plus
Dyak\GE24235-PA 219 GE24235-PA 4..218 3..220 207 25.2 Plus

RE01312.hyp Sequence

Translation from 373 to 1035

> RE01312.hyp
MASTSSVKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYV
GLGAAALLVVLWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQE
KTVASNLANALEATWEEELNSPGAMSLYQNWFQCCGRGSPQDYIVNERLP
PETCFRNHDKSKPENLIHTGCRVEFENYWQHLTKIFNILALVLIGFELLL
SVISCRLCNSIRNDARRSYF*

RE01312.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Ef-PA 220 CG12845-PA 1..220 1..220 1150 100 Plus
Tsp42Ei-PB 229 CG12843-PB 6..224 5..218 266 29 Plus
Tsp42Ei-PA 229 CG12843-PA 6..224 5..218 266 29 Plus
Tsp42Ea-PC 226 CG18817-PC 6..226 5..220 257 27.9 Plus
Tsp42Ea-PB 226 CG18817-PB 6..226 5..220 257 27.9 Plus