Clone RE01326 Report

Search the DGRC for RE01326

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:13
Well:26
Vector:pFlc-1
Associated Gene/TranscriptCG42455-RB
Protein status:RE01326.pep: gold
Sequenced Size:1124

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG42455-RA 2009-08-31 Manual selection by Joe Carlson

Clone Sequence Records

RE01326.complete Sequence

1124 bp assembled on 2009-10-24

GenBank Submission: BT100174.1

> RE01326.complete
ATTAGTCTATACTATTAGCAGTATGATTGGTATTCTCTGCAAACTAAGAT
ATCTTGGAATTTCGGCCCACGCAAACTCTGGTCAGACTGGTGCCGGTGTA
TAAACTTAGTGTGGAAGAAGTGTGCTCATTCGCGAATATAAATAAATTAA
ACAGCCAGAATGTCCCTGCAAACGGGCTTGGCTTTCATTTTCACCATATT
AGCCTCTGTTAGTATCGTCGCAGCAATTATTTTGTTGGGCTGGTTCCTCA
TCTGGAAGGCGTTTCTATCGAAATTTCGTCTGGTTCGAGAGCTGTTGGGT
CAGGAGGAGCCGGAGGATCAGCAACCACTTGCTTGGGATCATCAGAATCA
ACAGCCACACCACCACGGCAGAGCCAGGAAAGCTCGCCGAGACTAGGAAG
CACATCTACACAGCCTCACCATGAACATCCGCTGCGCAAAACCGGAAGAC
CTAATGACCATGCAGCACTGCAATCTGCTGTGTCTACCCGAAAACTACCA
GATGAAGTACTACTTTTACCACGGACTAACCTGGCCTCAGCTTAGCTACG
TGGCCGTTGACGACAAGGGCGCCATTGTGGGCTATGTCCTGGCCAAGATG
GAGGAGCCGGAGCCCAATGAGGAGAGCCGCCATGGGCACATCACCTCGCT
AGCGGTCAAGCGTTCCTATCGGCGATTGGGCCTGGCCCAGAAGCTCATGA
ATCAGGCCTCCCAGGCCATGGTCGAGTGCTTCAATGCCCAGTACGTGTCC
CTGCACGTGAGGAAGAGCAATCGGGCTGCCCTGAACCTCTACACCAACGC
CCTCAAGTTCAAGATCATCGAGGTGGAGCCCAAGTACTATGCCGATGGCG
AGGATGCATATGCCATGCGACGCGACCTCAGCGAGTTTGCCGATGAGGAT
CAGGCCAAGGCTGCGAAGCAGTCAGGCGAGGAGGAGGAGAAGGCGGTCCA
CAGATCCGGCGGACATGGCCACTCGCACAACCACAGCGGTCACGATGGCC
ATTGTTGCTGAACACTTTCGCTGCCGGCGCTTGCTGGCTTCGACGTTTTT
TGCATTTTTGTGCATTAGGGTTTTGTAATTATTTAACAATAAAAAACGTA
ACTAAAATTAAAAAAAAAAAAAAA

RE01326.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG42455-RB 1165 CG42455-RB 13..1115 16..1118 5500 99.9 Plus
CG42455-RC 1206 CG42455-RC 195..1156 157..1118 4795 99.8 Plus
Ard1-RC 1206 Ard1-RC 195..1156 157..1118 4795 99.8 Plus
CG42455-RC 1206 CG42455-RC 13..155 16..158 715 100 Plus
Ard1-RC 1206 Ard1-RC 13..155 16..158 715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9964880..9965751 238..1109 4360 100 Plus
chr3L 24539361 chr3L 9964042..9964184 16..158 715 100 Plus
chr3L 24539361 chr3L 9964707..9964789 157..239 415 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9973093..9973973 238..1118 4390 99.9 Plus
3L 28110227 3L 9972255..9972397 16..158 715 100 Plus
3L 28110227 3L 9972920..9973002 157..239 415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9966193..9967073 238..1118 4390 99.8 Plus
3L 28103327 3L 9965355..9965497 16..158 715 100 Plus
3L 28103327 3L 9966020..9966102 157..239 415 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:15:27 has no hits.

RE01326.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:16:19 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9964881..9965751 239..1109 100   Plus
chr3L 9964030..9964184 1..158 96 -> Plus
chr3L 9964709..9964788 159..238 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-24 10:21:55 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
Ard1-RC 1..591 421..1011 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:47:06 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
Ard1-RC 1..591 421..1011 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:18:00 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RD 1..591 421..1011 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:02:37 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RD 1..591 421..1011 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-24 10:21:53 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
Ard1-RA 1..1106 4..1109 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:47:06 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
Ard1-RA 1..1106 4..1109 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:18:00 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
CG42455-RB 1..1037 73..1109 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:02:37 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
CG42455-RB 1..1037 73..1109 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:19 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9972243..9972397 1..158 96 -> Plus
3L 9972922..9973001 159..238 100 -> Plus
3L 9973094..9973964 239..1109 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:19 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9972243..9972397 1..158 96 -> Plus
3L 9972922..9973001 159..238 100 -> Plus
3L 9973094..9973964 239..1109 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:19 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9972243..9972397 1..158 96 -> Plus
3L 9972922..9973001 159..238 100 -> Plus
3L 9973094..9973964 239..1109 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:18:00 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9965343..9965497 1..158 96 -> Plus
arm_3L 9966022..9966101 159..238 100 -> Plus
arm_3L 9966194..9967064 239..1109 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:53 Download gff for RE01326.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9965343..9965497 1..158 96 -> Plus
3L 9966022..9966101 159..238 100 -> Plus
3L 9966194..9967064 239..1109 100   Plus

RE01326.pep Sequence

Translation from 159 to 395

> RE01326.pep
MSLQTGLAFIFTILASVSIVAAIILLGWFLIWKAFLSKFRLVRELLGQEE
PEDQQPLAWDHQNQQPHHHGRARKARRD*

RE01326.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10585-PA 78 GF10585-PA 1..78 1..78 345 87.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15425-PA 78 GG15425-PA 1..78 1..78 386 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16054-PA 76 GH16054-PA 1..76 1..78 226 76.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42455-PC 78 CG42455-PC 1..78 1..78 407 100 Plus
CG42455-PB 78 CG42455-PB 1..78 1..78 407 100 Plus
CG42455-PA 78 CG42455-PA 1..78 1..78 407 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23477-PA 74 GA23477-PA 1..74 1..78 220 74.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25198-PA 78 GM25198-PA 1..78 1..78 396 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14229-PA 78 GD14229-PA 1..78 1..78 386 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13254-PA 73 GJ13254-PA 1..73 1..78 303 84.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17455-PA 113 GK17455-PA 1..113 1..78 181 51.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21733-PA 78 GE21733-PA 1..78 1..78 389 96.2 Plus

RE01326.hyp Sequence

Translation from 420 to 1010

> RE01326.hyp
MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKG
AIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAM
VECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMR
RDLSEFADEDQAKAAKQSGEEEEKAVHRSGGHGHSHNHSGHDGHCC*

RE01326.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
vnc-PB 196 CG11989-PB 1..196 1..196 1054 100 Plus
vnc-PC 196 CG11989-PC 1..196 1..196 1054 100 Plus
vnc-PD 196 CG11989-PD 1..196 1..196 1054 100 Plus
vnc-PE 196 CG11989-PE 1..196 1..196 1054 100 Plus
vnc-PA 196 CG11989-PA 1..196 1..196 1054 100 Plus