RE01326.complete Sequence
1124 bp assembled on 2009-10-24
GenBank Submission: BT100174.1
> RE01326.complete
ATTAGTCTATACTATTAGCAGTATGATTGGTATTCTCTGCAAACTAAGAT
ATCTTGGAATTTCGGCCCACGCAAACTCTGGTCAGACTGGTGCCGGTGTA
TAAACTTAGTGTGGAAGAAGTGTGCTCATTCGCGAATATAAATAAATTAA
ACAGCCAGAATGTCCCTGCAAACGGGCTTGGCTTTCATTTTCACCATATT
AGCCTCTGTTAGTATCGTCGCAGCAATTATTTTGTTGGGCTGGTTCCTCA
TCTGGAAGGCGTTTCTATCGAAATTTCGTCTGGTTCGAGAGCTGTTGGGT
CAGGAGGAGCCGGAGGATCAGCAACCACTTGCTTGGGATCATCAGAATCA
ACAGCCACACCACCACGGCAGAGCCAGGAAAGCTCGCCGAGACTAGGAAG
CACATCTACACAGCCTCACCATGAACATCCGCTGCGCAAAACCGGAAGAC
CTAATGACCATGCAGCACTGCAATCTGCTGTGTCTACCCGAAAACTACCA
GATGAAGTACTACTTTTACCACGGACTAACCTGGCCTCAGCTTAGCTACG
TGGCCGTTGACGACAAGGGCGCCATTGTGGGCTATGTCCTGGCCAAGATG
GAGGAGCCGGAGCCCAATGAGGAGAGCCGCCATGGGCACATCACCTCGCT
AGCGGTCAAGCGTTCCTATCGGCGATTGGGCCTGGCCCAGAAGCTCATGA
ATCAGGCCTCCCAGGCCATGGTCGAGTGCTTCAATGCCCAGTACGTGTCC
CTGCACGTGAGGAAGAGCAATCGGGCTGCCCTGAACCTCTACACCAACGC
CCTCAAGTTCAAGATCATCGAGGTGGAGCCCAAGTACTATGCCGATGGCG
AGGATGCATATGCCATGCGACGCGACCTCAGCGAGTTTGCCGATGAGGAT
CAGGCCAAGGCTGCGAAGCAGTCAGGCGAGGAGGAGGAGAAGGCGGTCCA
CAGATCCGGCGGACATGGCCACTCGCACAACCACAGCGGTCACGATGGCC
ATTGTTGCTGAACACTTTCGCTGCCGGCGCTTGCTGGCTTCGACGTTTTT
TGCATTTTTGTGCATTAGGGTTTTGTAATTATTTAACAATAAAAAACGTA
ACTAAAATTAAAAAAAAAAAAAAA
RE01326.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:56:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42455-RB | 1165 | CG42455-RB | 13..1115 | 16..1118 | 5500 | 99.9 | Plus |
CG42455-RC | 1206 | CG42455-RC | 195..1156 | 157..1118 | 4795 | 99.8 | Plus |
Ard1-RC | 1206 | Ard1-RC | 195..1156 | 157..1118 | 4795 | 99.8 | Plus |
CG42455-RC | 1206 | CG42455-RC | 13..155 | 16..158 | 715 | 100 | Plus |
Ard1-RC | 1206 | Ard1-RC | 13..155 | 16..158 | 715 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:15:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 9964880..9965751 | 238..1109 | 4360 | 100 | Plus |
chr3L | 24539361 | chr3L | 9964042..9964184 | 16..158 | 715 | 100 | Plus |
chr3L | 24539361 | chr3L | 9964707..9964789 | 157..239 | 415 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:15:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 9973093..9973973 | 238..1118 | 4390 | 99.9 | Plus |
3L | 28110227 | 3L | 9972255..9972397 | 16..158 | 715 | 100 | Plus |
3L | 28110227 | 3L | 9972920..9973002 | 157..239 | 415 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 9966193..9967073 | 238..1118 | 4390 | 99.8 | Plus |
3L | 28103327 | 3L | 9965355..9965497 | 16..158 | 715 | 100 | Plus |
3L | 28103327 | 3L | 9966020..9966102 | 157..239 | 415 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 02:15:27 has no hits.
RE01326.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:16:19 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 9964881..9965751 | 239..1109 | 100 | | Plus |
chr3L | 9964030..9964184 | 1..158 | 96 | -> | Plus |
chr3L | 9964709..9964788 | 159..238 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-24 10:21:55 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ard1-RC | 1..591 | 421..1011 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:47:06 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ard1-RC | 1..591 | 421..1011 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:18:00 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
vnc-RD | 1..591 | 421..1011 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:02:37 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
vnc-RD | 1..591 | 421..1011 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-24 10:21:53 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ard1-RA | 1..1106 | 4..1109 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:47:06 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ard1-RA | 1..1106 | 4..1109 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:18:00 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42455-RB | 1..1037 | 73..1109 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:02:37 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42455-RB | 1..1037 | 73..1109 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:19 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9972243..9972397 | 1..158 | 96 | -> | Plus |
3L | 9972922..9973001 | 159..238 | 100 | -> | Plus |
3L | 9973094..9973964 | 239..1109 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:19 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9972243..9972397 | 1..158 | 96 | -> | Plus |
3L | 9972922..9973001 | 159..238 | 100 | -> | Plus |
3L | 9973094..9973964 | 239..1109 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:16:19 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9972243..9972397 | 1..158 | 96 | -> | Plus |
3L | 9972922..9973001 | 159..238 | 100 | -> | Plus |
3L | 9973094..9973964 | 239..1109 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:18:00 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 9965343..9965497 | 1..158 | 96 | -> | Plus |
arm_3L | 9966022..9966101 | 159..238 | 100 | -> | Plus |
arm_3L | 9966194..9967064 | 239..1109 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:53 Download gff for
RE01326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9965343..9965497 | 1..158 | 96 | -> | Plus |
3L | 9966022..9966101 | 159..238 | 100 | -> | Plus |
3L | 9966194..9967064 | 239..1109 | 100 | | Plus |
RE01326.pep Sequence
Translation from 159 to 395
> RE01326.pep
MSLQTGLAFIFTILASVSIVAAIILLGWFLIWKAFLSKFRLVRELLGQEE
PEDQQPLAWDHQNQQPHHHGRARKARRD*
RE01326.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:50:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10585-PA | 78 | GF10585-PA | 1..78 | 1..78 | 345 | 87.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:50:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15425-PA | 78 | GG15425-PA | 1..78 | 1..78 | 386 | 96.2 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:50:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH16054-PA | 76 | GH16054-PA | 1..76 | 1..78 | 226 | 76.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42455-PC | 78 | CG42455-PC | 1..78 | 1..78 | 407 | 100 | Plus |
CG42455-PB | 78 | CG42455-PB | 1..78 | 1..78 | 407 | 100 | Plus |
CG42455-PA | 78 | CG42455-PA | 1..78 | 1..78 | 407 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:50:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA23477-PA | 74 | GA23477-PA | 1..74 | 1..78 | 220 | 74.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:50:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25198-PA | 78 | GM25198-PA | 1..78 | 1..78 | 396 | 98.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:50:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14229-PA | 78 | GD14229-PA | 1..78 | 1..78 | 386 | 97.4 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:50:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ13254-PA | 73 | GJ13254-PA | 1..73 | 1..78 | 303 | 84.6 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:50:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK17455-PA | 113 | GK17455-PA | 1..113 | 1..78 | 181 | 51.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:50:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21733-PA | 78 | GE21733-PA | 1..78 | 1..78 | 389 | 96.2 | Plus |
RE01326.hyp Sequence
Translation from 420 to 1010
> RE01326.hyp
MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKG
AIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAM
VECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMR
RDLSEFADEDQAKAAKQSGEEEEKAVHRSGGHGHSHNHSGHDGHCC*
RE01326.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:20:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
vnc-PB | 196 | CG11989-PB | 1..196 | 1..196 | 1054 | 100 | Plus |
vnc-PC | 196 | CG11989-PC | 1..196 | 1..196 | 1054 | 100 | Plus |
vnc-PD | 196 | CG11989-PD | 1..196 | 1..196 | 1054 | 100 | Plus |
vnc-PE | 196 | CG11989-PE | 1..196 | 1..196 | 1054 | 100 | Plus |
vnc-PA | 196 | CG11989-PA | 1..196 | 1..196 | 1054 | 100 | Plus |