Clone RE01362 Report

Search the DGRC for RE01362

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:13
Well:62
Vector:pFlc-1
Associated Gene/TranscriptSpdS-RA
Protein status:RE01362.pep: gold
Preliminary Size:1455
Sequenced Size:1484

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8327 2002-11-22 Blastp of sequenced clone
SpdS 2008-04-29 Release 5.5 accounting
SpdS 2008-08-15 Release 5.9 accounting
SpdS 2008-12-18 5.12 accounting

Clone Sequence Records

RE01362.complete Sequence

1484 bp (1484 high quality bases) assembled on 2002-11-22

GenBank Submission: BT003549

> RE01362.complete
CTTTTCAAACGCCGATTCGAATGCGGCATTAAACAAATGGATTCCCTTAA
CAACGGATGGTTCAGCGAACTGCAGGCCGATCTCTGGCCCGGTCAGTCAT
TCTCCCTGAAAGTCAAGGAGGTCATCCACAAGGAGAAGTCCCGGTTCCAA
GACATCCAGATCGTTGAAACCGAAACCTATGGACGGTGCCTAATTCTGGA
CGGAATCATTCAGTGCACGGCCAGGGATGAGTTCTCGTACCAGGAGATGA
TATCTTTCCTGCCGCTCTGCGCCCATCCCAATCCCAAAAAGGTCCTGATC
GTGGGCGGTGGCGATGGCGGCGTTGCTCGCGAGGTGGTAAAGCATCCACT
GGTCGAGGAAGTGCATCAGGTGGAAATCGACGACCGTGTCGTCGAGCTGT
CCAAGCAATATCTCCCAGCGATGGCCTGTGGTTTCGCCAACGAGAAGTTG
AAGCTTACCATTGGCGATGGATTCGACTATATGAAGAAACACAAGAACGA
ATTTGATGTCATCATCACCGACAGCTCGGATCCCATTGGTCCGGCAGTGA
GCCTGTTTCAGGAAAGCTACTACGAGCTAATGAAACACGCGCTGAAGGAT
GACGGAATCGTGTGCTCCCAGGGCGGTAGCTTCTGGCTGGACCTGGACTA
CATCAAGAAGACCATGTCCGGCTGCAAGGAGCACTTTGCTAAGGTGGCCT
ATGCCGTCACCTCCGTTCCGTCCTATCCCTGCGGCCACATTGGCTTCGTC
ATGGGCTCCCTGAACAAAAACCAGGACTTCGCTACTCCCAAGCTTGGAAA
GTCCGAAATCGATTCTATAGACCTAAGGTACTACTCCTCCGAGGTTCACT
CCGCCGCCTTTGCCTTGCCTCGATGGGTGCAGAAGCACTTTTACGAATGA
CCAGGTTGCGGAAAGATTCGTGTGTATCTGTTTGTTAAAAATAAATATGA
TAATAATATGACTTGTTTATCATCGCTTCTTAAATTCTTGGATATTTTCA
ACAAATGCTGACTCTTGCAATGATTCATTTTTAGTCGAATTTTTGTAGCC
TGAGTATTTTCCTTCCAATCCGACTACCATCTTTCAGTTATTTTACTGTT
GAAAATAGAACAAATTGTAATGTTTATTACGTAATGATATATACAGTTGG
CTCTATTTAATTTTTGTATTTGTAAGTGGATGCTGGGTTAACATAATGAG
ACTTATTGCAATATTTTACACGACCGAATGTTACTCTCATTTATATATCG
CATATATTGCAAAACTTTGAAAGGAAGCGTTTCTTATATGCAAAAATGAC
CTTAACTGCATGTGAATAATTAACTAAAAACTGATATTCAATTTCAATAA
CTTAATAGAAATTAAATCTTCAACCTGTTTAATGACTAATTAAATATTGT
TATAGTTAGGAAACGCAATTGATACATAATTACAAAATTAGATGTAAAAT
ATGTACAATCATTTAAAGAAAAAAAAAAAAAAAA

RE01362.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
SpdS-RA 1518 SpdS-RA 52..1517 1..1466 7315 99.9 Plus
SpdS.b 1889 SpdS.b 593..1888 171..1466 6480 100 Plus
SpdS-RB 1707 SpdS-RB 411..1706 171..1466 6480 100 Plus
SpdS.b 1889 SpdS.b 47..216 1..170 835 99.4 Plus
SpdS-RB 1707 SpdS-RB 47..216 1..170 835 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5458191..5459486 171..1466 6465 99.9 Plus
chr3R 27901430 chr3R 5457499..5457668 1..170 835 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9632377..9633672 171..1466 6480 100 Plus
3R 32079331 3R 9631685..9631854 1..170 835 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9373208..9374503 171..1466 6480 100 Plus
3R 31820162 3R 9372516..9372685 1..170 835 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 22:18:34 has no hits.

RE01362.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:27 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5457499..5457668 1..170 99 -> Plus
chr3R 5458191..5459486 171..1468 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:35 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 1..864 37..900 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:03:21 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 1..864 37..900 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:44 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 1..864 37..900 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:53:36 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 1..864 37..900 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:38:17 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 1..864 37..900 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:21:54 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 27..1492 1..1466 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:03:20 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 47..1513 1..1467 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:44 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 45..1511 1..1467 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:53:38 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 27..1492 1..1466 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:38:17 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 45..1511 1..1467 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:27 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9631685..9631854 1..170 99 -> Plus
3R 9632377..9633672 171..1468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:27 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9631685..9631854 1..170 99 -> Plus
3R 9632377..9633672 171..1468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:27 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9631685..9631854 1..170 99 -> Plus
3R 9632377..9633672 171..1468 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:44 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5457407..5457576 1..170 99 -> Plus
arm_3R 5458099..5459394 171..1468 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:25:48 Download gff for RE01362.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9373208..9374503 171..1468 99   Plus
3R 9372516..9372685 1..170 99 -> Plus

RE01362.hyp Sequence

Translation from 0 to 899

> RE01362.hyp
LIKRRFECGIKQMDSLNNGWFSELQADLWPGQSFSLKVKEVIHKEKSRFQ
DIQIVETETYGRCLILDGIIQCTARDEFSYQEMISFLPLCAHPNPKKVLI
VGGGDGGVAREVVKHPLVEEVHQVEIDDRVVELSKQYLPAMACGFANEKL
KLTIGDGFDYMKKHKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKD
DGIVCSQGGSFWLDLDYIKKTMSGCKEHFAKVAYAVTSVPSYPCGHIGFV
MGSLNKNQDFATPKLGKSEIDSIDLRYYSSEVHSAAFALPRWVQKHFYE*

RE01362.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
SpdS-PC 287 CG8327-PC 1..287 13..299 1526 100 Plus
SpdS-PA 287 CG8327-PA 1..287 13..299 1526 100 Plus
SpdS-PB 217 CG8327-PB 1..217 83..299 1155 100 Plus
CG4300-PA 367 CG4300-PA 103..320 1..208 158 26.6 Plus
CG4300-PD 458 CG4300-PD 103..320 1..208 158 26.6 Plus

RE01362.pep Sequence

Translation from 36 to 899

> RE01362.pep
MDSLNNGWFSELQADLWPGQSFSLKVKEVIHKEKSRFQDIQIVETETYGR
CLILDGIIQCTARDEFSYQEMISFLPLCAHPNPKKVLIVGGGDGGVAREV
VKHPLVEEVHQVEIDDRVVELSKQYLPAMACGFANEKLKLTIGDGFDYMK
KHKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKDDGIVCSQGGSFW
LDLDYIKKTMSGCKEHFAKVAYAVTSVPSYPCGHIGFVMGSLNKNQDFAT
PKLGKSEIDSIDLRYYSSEVHSAAFALPRWVQKHFYE*

RE01362.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16181-PA 287 GF16181-PA 1..286 1..286 1488 95.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16982-PA 287 GG16982-PA 1..287 1..287 1519 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18040-PA 289 GH18040-PA 1..289 1..287 1283 80.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
SpdS-PC 287 CG8327-PC 1..287 1..287 1526 100 Plus
SpdS-PA 287 CG8327-PA 1..287 1..287 1526 100 Plus
SpdS-PB 217 CG8327-PB 1..217 71..287 1155 100 Plus
Sms-PB 366 CG4300-PB 140..319 26..196 156 30.4 Plus
Sms-PA 367 CG4300-PA 141..320 26..196 156 30.4 Plus
Sms-PC 457 CG4300-PC 140..319 26..196 156 30.4 Plus
Sms-PD 458 CG4300-PD 141..320 26..196 156 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23961-PA 289 GI23961-PA 1..289 1..287 1272 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21885-PA 197 GL21885-PA 1..195 1..195 930 86.7 Plus
Dper\GL25003-PA 367 GL25003-PA 141..321 26..197 156 31.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20990-PA 292 GA20990-PA 1..285 1..283 1298 82.5 Plus
Dpse\GA18092-PB 369 GA18092-PB 143..323 26..197 156 31.2 Plus
Dpse\GA18092-PA 367 GA18092-PA 141..321 26..197 156 31.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23823-PA 287 GM23823-PA 1..287 1..287 1522 98.6 Plus
Dsec\GM24668-PA 367 GM24668-PA 141..321 26..197 146 30.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18634-PA 279 GD18634-PA 1..279 1..287 1327 88.7 Plus
Dsim\GD12732-PA 420 GD12732-PA 194..374 26..197 150 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11148-PA 304 GJ11148-PA 35..299 23..285 1125 74.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10845-PA 289 GK10845-PA 1..289 1..287 1320 84.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25970-PA 287 GE25970-PA 1..287 1..287 1527 98.6 Plus
Dyak\GE20131-PA 467 GE20131-PA 241..421 26..197 151 31.2 Plus