BDGP Sequence Production Resources |
Search the DGRC for RE01373
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 13 |
Well: | 73 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL15-RE |
Protein status: | RE01373.pep: gold |
Preliminary Size: | 1019 |
Sequenced Size: | 724 |
Gene | Date | Evidence |
---|---|---|
CG17420 | 2002-01-01 | Sim4 clustering to Release 2 |
CG40199 | 2002-03-28 | Blastp of sequenced clone |
CG17420 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL15 | 2008-04-29 | Release 5.5 accounting |
RpL15 | 2008-08-15 | Release 5.9 accounting |
RpL15 | 2008-12-18 | 5.12 accounting |
724 bp (724 high quality bases) assembled on 2002-03-28
GenBank Submission: AY094841
> RE01373.complete CCTTTTTTTTTTTGGAATATTTCCGTGCTGTCTATCAAATTGCAGAGATG GGGGCTTATCGGTACATGCAGGAACTTTATAGGAAGAAGCAGAGCGATGT GATGCGCTACTTGCTACGTATTCGCGTTTGGCAATACCGCCAACTAACGA AATTGCATCGTTCGCCAAGACCTACTCGCCCGGATAAAGCAAGACGTTTA GGATACAGAGCCAAACAGGGGTTCGTGATTTATAGAATCCGTGTTCGCCG CGGAGGTCGCAAGCGTCCAGTTCCCAAAGGATGCACTTATGGCAAGCCGA AGAGTCATGGTGTAAACCAGTTAAAACCATATCGTGGTTTGCAATCCATT GCTGAGGAACGTGTTGGTCGTAGACTTGGCGGCTTGCGAGTTTTGAACTC GTATTGGATTGCGCAAGATGCTTCTTATAAATATTTTGAAGTAATCTTAA TTGATACTCATCACAGTGCTATTCGTCGTGATCCAAAAATTAACTGGATC TGCAAGCATGTCCACAAGCATCGTGAATTGCGTGGCCTTACATCAGCTGG AAAAAGTTCGCGTGGCATTGGCAAGGGATATAGATACTCCCAGACAATTG GTGGATCTAGGCGTGCTGCTTGGAAGCGCAAGAACCGTGAGCACATGCAC AGAAAACGATAAATTGTGAAGCATTTATTTTATCGGTTAAATAAAGCACT TCGTGCACGCAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ZAM | 8435 | ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). | 3070..3129 | 451..390 | 115 | 69.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3LHet | 2398090..2398416 | 30..356 | 100 | -> | Plus |
chr3LHet | 2398590..2398943 | 357..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RD | 62..702 | 21..662 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RC | 1..615 | 48..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RG | 1..615 | 48..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RD | 62..702 | 21..662 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RG | 1..615 | 48..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RA | 1..697 | 14..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RA | 13..709 | 14..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RA | 13..709 | 14..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RA | 1..697 | 14..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL15-RA | 13..709 | 14..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 27267592..27267918 | 30..356 | 100 | -> | Plus |
3L | 27268092..27268445 | 357..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 27267592..27267918 | 30..356 | 100 | -> | Plus |
3L | 27268092..27268445 | 357..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 27267592..27267918 | 30..356 | 100 | -> | Plus |
3L | 27268092..27268445 | 357..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3LHet | 2398128..2398454 | 30..356 | 100 | -> | Plus |
3LHet | 2398628..2398981 | 357..710 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 27260692..27261018 | 30..356 | 100 | -> | Plus |
3L | 27261192..27261545 | 357..710 | 100 | Plus |
Translation from 30 to 661
> RE01373.hyp VYQIAEMGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTR PDKARRLGYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKP YRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRR DPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKR KNREHMHRKR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL15-PI | 204 | CG17420-PI | 1..204 | 7..210 | 1095 | 100 | Plus |
RpL15-PH | 204 | CG17420-PH | 1..204 | 7..210 | 1095 | 100 | Plus |
RpL15-PG | 204 | CG17420-PG | 1..204 | 7..210 | 1095 | 100 | Plus |
RpL15-PF | 204 | CG17420-PF | 1..204 | 7..210 | 1095 | 100 | Plus |
RpL15-PE | 204 | CG17420-PE | 1..204 | 7..210 | 1095 | 100 | Plus |
Translation from 47 to 661
> RE01373.pep MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARR LGYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQS IAEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRRDPKINW ICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRKNREHM HRKR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20530-PA | 204 | GF20530-PA | 1..204 | 1..204 | 1050 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16327-PA | 204 | GG16327-PA | 1..204 | 1..204 | 1055 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18039-PA | 204 | GH18039-PA | 1..204 | 1..204 | 1023 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL15-PI | 204 | CG17420-PI | 1..204 | 1..204 | 1095 | 100 | Plus |
RpL15-PH | 204 | CG17420-PH | 1..204 | 1..204 | 1095 | 100 | Plus |
RpL15-PG | 204 | CG17420-PG | 1..204 | 1..204 | 1095 | 100 | Plus |
RpL15-PF | 204 | CG17420-PF | 1..204 | 1..204 | 1095 | 100 | Plus |
RpL15-PE | 204 | CG17420-PE | 1..204 | 1..204 | 1095 | 100 | Plus |
RpL15-PC | 204 | CG17420-PC | 1..204 | 1..204 | 1095 | 100 | Plus |
RpL15-PB | 204 | CG17420-PB | 1..204 | 1..204 | 1095 | 100 | Plus |
RpL15-PA | 204 | CG17420-PA | 1..204 | 1..204 | 1095 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23964-PA | 204 | GI23964-PA | 1..204 | 1..204 | 1036 | 97.1 | Plus |
Dmoj\GI20870-PA | 123 | GI20870-PA | 1..122 | 19..145 | 184 | 37.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21879-PA | 204 | GL21879-PA | 1..204 | 1..204 | 1055 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22222-PA | 204 | GA22222-PA | 1..204 | 1..204 | 1055 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25206-PA | 204 | GM25206-PA | 1..204 | 1..204 | 1055 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11941-PA | 204 | GD11941-PA | 1..204 | 1..204 | 1055 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\RpL15-PA | 204 | GJ22514-PA | 1..204 | 1..204 | 1036 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12236-PA | 204 | GK12236-PA | 1..204 | 1..204 | 1020 | 95.6 | Plus |
Dwil\GK18626-PA | 200 | GK18626-PA | 1..40 | 1..40 | 183 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL15-PA | 204 | GE19709-PA | 1..204 | 1..204 | 1055 | 100 | Plus |