Clone RE01373 Report

Search the DGRC for RE01373

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:13
Well:73
Vector:pFlc-1
Associated Gene/TranscriptRpL15-RE
Protein status:RE01373.pep: gold
Preliminary Size:1019
Sequenced Size:724

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17420 2002-01-01 Sim4 clustering to Release 2
CG40199 2002-03-28 Blastp of sequenced clone
CG17420 2003-01-01 Sim4 clustering to Release 3
RpL15 2008-04-29 Release 5.5 accounting
RpL15 2008-08-15 Release 5.9 accounting
RpL15 2008-12-18 5.12 accounting

Clone Sequence Records

RE01373.complete Sequence

724 bp (724 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094841

> RE01373.complete
CCTTTTTTTTTTTGGAATATTTCCGTGCTGTCTATCAAATTGCAGAGATG
GGGGCTTATCGGTACATGCAGGAACTTTATAGGAAGAAGCAGAGCGATGT
GATGCGCTACTTGCTACGTATTCGCGTTTGGCAATACCGCCAACTAACGA
AATTGCATCGTTCGCCAAGACCTACTCGCCCGGATAAAGCAAGACGTTTA
GGATACAGAGCCAAACAGGGGTTCGTGATTTATAGAATCCGTGTTCGCCG
CGGAGGTCGCAAGCGTCCAGTTCCCAAAGGATGCACTTATGGCAAGCCGA
AGAGTCATGGTGTAAACCAGTTAAAACCATATCGTGGTTTGCAATCCATT
GCTGAGGAACGTGTTGGTCGTAGACTTGGCGGCTTGCGAGTTTTGAACTC
GTATTGGATTGCGCAAGATGCTTCTTATAAATATTTTGAAGTAATCTTAA
TTGATACTCATCACAGTGCTATTCGTCGTGATCCAAAAATTAACTGGATC
TGCAAGCATGTCCACAAGCATCGTGAATTGCGTGGCCTTACATCAGCTGG
AAAAAGTTCGCGTGGCATTGGCAAGGGATATAGATACTCCCAGACAATTG
GTGGATCTAGGCGTGCTGCTTGGAAGCGCAAGAACCGTGAGCACATGCAC
AGAAAACGATAAATTGTGAAGCATTTATTTTATCGGTTAAATAAAGCACT
TCGTGCACGCAAAAAAAAAAAAAA

RE01373.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
RpL15-RA 869 RpL15-RA 50..753 10..713 3520 100 Plus
RpL15.e 1051 RpL15.e 251..935 29..713 3425 100 Plus
RpL15.d 1016 RpL15.d 216..900 29..713 3425 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3LHet 2555433 chr3LHet 2398588..2398943 355..710 1780 100 Plus
chr3LHet 2555433 chr3LHet 2398090..2398417 30..357 1640 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 27268090..27268448 355..713 1795 100 Plus
3L 28110227 3L 27267592..27267919 30..357 1640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 27261190..27261548 355..713 1795 100 Plus
3L 28103327 3L 27260692..27261019 30..357 1640 100 Plus
Blast to na_te.dros performed 2019-03-15 19:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 3070..3129 451..390 115 69.4 Minus

RE01373.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:48 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
chr3LHet 2398090..2398416 30..356 100 -> Plus
chr3LHet 2398590..2398943 357..710 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:37 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RD 62..702 21..662 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:24:07 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RC 1..615 48..662 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:51:03 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RG 1..615 48..662 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:00:09 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RD 62..702 21..662 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:58 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RG 1..615 48..662 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:50:53 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RA 1..697 14..710 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:24:06 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RA 13..709 14..710 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:51:03 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RA 13..709 14..710 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:00:10 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RA 1..697 14..710 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:58 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
RpL15-RA 13..709 14..710 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:48 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
3L 27267592..27267918 30..356 100 -> Plus
3L 27268092..27268445 357..710 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:48 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
3L 27267592..27267918 30..356 100 -> Plus
3L 27268092..27268445 357..710 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:48 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
3L 27267592..27267918 30..356 100 -> Plus
3L 27268092..27268445 357..710 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:51:03 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
3LHet 2398128..2398454 30..356 100 -> Plus
3LHet 2398628..2398981 357..710 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:33:07 Download gff for RE01373.complete
Subject Subject Range Query Range Percent Splice Strand
3L 27260692..27261018 30..356 100 -> Plus
3L 27261192..27261545 357..710 100   Plus

RE01373.hyp Sequence

Translation from 30 to 661

> RE01373.hyp
VYQIAEMGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTR
PDKARRLGYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKP
YRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRR
DPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKR
KNREHMHRKR*

RE01373.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
RpL15-PI 204 CG17420-PI 1..204 7..210 1095 100 Plus
RpL15-PH 204 CG17420-PH 1..204 7..210 1095 100 Plus
RpL15-PG 204 CG17420-PG 1..204 7..210 1095 100 Plus
RpL15-PF 204 CG17420-PF 1..204 7..210 1095 100 Plus
RpL15-PE 204 CG17420-PE 1..204 7..210 1095 100 Plus

RE01373.pep Sequence

Translation from 47 to 661

> RE01373.pep
MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARR
LGYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQS
IAEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRRDPKINW
ICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRKNREHM
HRKR*

RE01373.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20530-PA 204 GF20530-PA 1..204 1..204 1050 99 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16327-PA 204 GG16327-PA 1..204 1..204 1055 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18039-PA 204 GH18039-PA 1..204 1..204 1023 95.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpL15-PI 204 CG17420-PI 1..204 1..204 1095 100 Plus
RpL15-PH 204 CG17420-PH 1..204 1..204 1095 100 Plus
RpL15-PG 204 CG17420-PG 1..204 1..204 1095 100 Plus
RpL15-PF 204 CG17420-PF 1..204 1..204 1095 100 Plus
RpL15-PE 204 CG17420-PE 1..204 1..204 1095 100 Plus
RpL15-PC 204 CG17420-PC 1..204 1..204 1095 100 Plus
RpL15-PB 204 CG17420-PB 1..204 1..204 1095 100 Plus
RpL15-PA 204 CG17420-PA 1..204 1..204 1095 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23964-PA 204 GI23964-PA 1..204 1..204 1036 97.1 Plus
Dmoj\GI20870-PA 123 GI20870-PA 1..122 19..145 184 37.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21879-PA 204 GL21879-PA 1..204 1..204 1055 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22222-PA 204 GA22222-PA 1..204 1..204 1055 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25206-PA 204 GM25206-PA 1..204 1..204 1055 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11941-PA 204 GD11941-PA 1..204 1..204 1055 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\RpL15-PA 204 GJ22514-PA 1..204 1..204 1036 97.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12236-PA 204 GK12236-PA 1..204 1..204 1020 95.6 Plus
Dwil\GK18626-PA 200 GK18626-PA 1..40 1..40 183 85 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL15-PA 204 GE19709-PA 1..204 1..204 1055 100 Plus