Clone RE01453 Report

Search the DGRC for RE01453

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:14
Well:53
Vector:pFlc-1
Associated Gene/TranscriptCG15211-RA
Protein status:RE01453.pep: gold
Sequenced Size:1203

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15211 2001-11-29 Blastp of sequenced clone
CG15211 2002-01-01 Sim4 clustering to Release 2
CG15211 2003-01-01 Sim4 clustering to Release 3
CG15211 2008-04-29 Release 5.5 accounting
CG15211 2008-08-15 Release 5.9 accounting
CG15211 2008-12-18 5.12 accounting

Clone Sequence Records

RE01453.complete Sequence

1203 bp (1203 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069765

> RE01453.complete
AGTCAGTCGACCAGCGGCCGCCGTGGACAAAGCAACGTAACGCCAAAGCA
ATCGCAGCGCAGCTCATGGATATATAGCTACAATATATAGAGTAGCTGCC
GATCGACCAGCGAACATATAGAAAGCGGTGGTTATTTTTCTCATCTTATT
TTATTGTGACAAAAATCGCGACAAGTGTTTAAAAATAGTTGTTGTGCCCA
GCTAATAAAGTAAACTTGCCCGCCAAACTGAAACTGAAACTGAAACTGAA
ACTAAGCCAAGCCAAACTATAAACAGCAACAATATGGTCGAGACCGTTGT
CAATATCGAGCGCACAACAACAACAACGACGAACGGACCGCCAGGTGGAG
CGAACCCGACCGTTGGCAGCGGTGGCGGCTTCTGGAGCGCCATTCGCCTC
AACATCGACTATTTCCGCACCATACCGGGCATCATCAAAATTGTGGAGTT
TGTGCTGGGCATCATCTGCATGGCCCTGGCAGCTCCTCCACTGGCCTCGG
CCACCTCGTTCTTCATGTTCGTCATCGTCATCTCGTTCATCATCAACATT
CTGCTGATCGCCGCCTATTTCCTGGGCATTCGCGAGGCCCTCAACGTGGC
CGTCAACTGGATATTCTCGGAGCTGATCACCACCGCTGTGCTGACGCTGC
TGTACTTCATCGGATTCATCGTCCAGCTGGCCAGATGGTCGGATGCCACG
GGCAAGGGTTCCGGTTCGAATACCGCCGCCGGTGTCTTTGGACTCTTCAA
TTTCCTGGCATACGCGGCGGGCACGTACTTCCTGTTCCTGGCCCACAGGT
CCGGGGCTACCCACTAAGTGCAGCCAACTCAGTGACTGGATCTTAGTCTA
GAGTTATTTCTAATTGTTTACAGAATAAGTGCAGATCGAGTACTTGTAAT
TTTGCCTCTTTTTTTTGTACTTTTGTTTTTTGTTGTTAATTAACGTATGC
AGCAGATTGACAATGGAAAGCGACATGGCTTTCTGTTTTTAATGTTATTT
TTATTTAAATGGCTAACTAACGTTTAAGTCTTAAATCCACCCGCACAAGA
CCATATCTACGAAAACGAGTAGGGTGGGCAGCCCATATAGTACATAACCT
TTTATCATTTCATGGCGTACATATAATGATTTTGTAATTTTTTTGAAATG
TATTCAATCGAGACAAAATAATATACGTAAATTAACTAAAAAAAAAAAAA
AAA

RE01453.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15211-RA 1391 CG15211-RA 4..1191 3..1190 5895 99.7 Plus
CG15211-RC 1397 CG15211-RC 90..1197 83..1190 5495 99.7 Plus
CG15211.a 1678 CG15211.a 309..1416 83..1190 5495 99.7 Plus
CG15211-RC 1397 CG15211-RC 4..88 3..87 425 100 Plus
CG15211.a 1678 CG15211.a 58..137 3..82 400 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10669542..10670108 619..1185 2820 99.8 Plus
chrX 22417052 chrX 10664131..10664502 83..454 1845 99.7 Plus
chrX 22417052 chrX 10669293..10669461 452..620 845 100 Plus
chrX 22417052 chrX 10663910..10663989 3..82 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10778210..10778781 619..1190 2830 99.7 Plus
X 23542271 X 10772798..10773169 83..454 1845 99.7 Plus
X 23542271 X 10777961..10778129 452..620 845 100 Plus
X 23542271 X 10772547..10772626 3..82 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10786308..10786879 619..1190 2830 99.6 Plus
X 23527363 X 10780896..10781267 83..454 1845 99.7 Plus
X 23527363 X 10786059..10786227 452..620 845 100 Plus
X 23527363 X 10780645..10780724 3..82 400 100 Plus
Blast to na_te.dros performed 2019-03-16 11:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 4160..4265 1034..928 135 62 Minus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 986..1098 1009..897 133 57.5 Minus
McClintock 6450 McClintock McCLINTOCK 6450bp 1152..1248 1006..911 131 60.8 Minus
Stalker4 7359 Stalker4 STALKER4 7359bp 3860..3965 1034..928 126 61.1 Minus
Stalker 7256 Stalker STALKER 7256bp 3754..3859 1034..928 126 61.1 Minus
gypsy9 5349 gypsy9 GYPSY9 5349bp 740..844 1014..910 119 62 Minus

RE01453.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:48:38 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10663907..10663989 1..82 98 -> Plus
chrX 10664131..10664499 83..451 91 -> Plus
chrX 10669293..10669460 452..619 100 -> Plus
chrX 10669543..10670100 620..1177 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:40 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RC 1..534 284..817 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:19:37 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RC 1..534 284..817 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:21:29 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RC 1..534 284..817 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:45:47 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RC 1..534 284..817 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:27:24 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RC 1..534 284..817 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:53:05 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RA 1..1187 1..1187 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:19:37 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RA 1..1187 1..1187 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:21:29 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RA 4..1190 1..1187 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:45:47 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RA 1..1187 1..1187 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:27:24 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
CG15211-RA 4..1190 1..1187 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:38 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
X 10772544..10772626 1..82 98 -> Plus
X 10772798..10773166 83..451 99 -> Plus
X 10777961..10778128 452..619 100 -> Plus
X 10778211..10778777 620..1187 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:38 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
X 10772544..10772626 1..82 98 -> Plus
X 10772798..10773166 83..451 99 -> Plus
X 10777961..10778128 452..619 100 -> Plus
X 10778211..10778777 620..1187 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:38 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
X 10772544..10772626 1..82 98 -> Plus
X 10772798..10773166 83..451 99 -> Plus
X 10777961..10778128 452..619 100 -> Plus
X 10778211..10778777 620..1187 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:21:29 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10671994..10672161 452..619 100 -> Plus
arm_X 10666577..10666659 1..82 98 -> Plus
arm_X 10666831..10667199 83..451 99 -> Plus
arm_X 10672244..10672810 620..1187 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:22:10 Download gff for RE01453.complete
Subject Subject Range Query Range Percent Splice Strand
X 10780896..10781264 83..451 99 -> Plus
X 10786059..10786226 452..619 100 -> Plus
X 10786309..10786875 620..1187 99   Plus
X 10780642..10780724 1..82 98 -> Plus

RE01453.hyp Sequence

Translation from 283 to 816

> RE01453.hyp
MVETVVNIERTTTTTTNGPPGGANPTVGSGGGFWSAIRLNIDYFRTIPGI
IKIVEFVLGIICMALAAPPLASATSFFMFVIVISFIINILLIAAYFLGIR
EALNVAVNWIFSELITTAVLTLLYFIGFIVQLARWSDATGKGSGSNTAAG
VFGLFNFLAYAAGTYFLFLAHRSGATH*

RE01453.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15211-PE 177 CG15211-PE 1..177 1..177 899 100 Plus
CG15211-PD 177 CG15211-PD 1..177 1..177 899 100 Plus
CG15211-PC 177 CG15211-PC 1..177 1..177 899 100 Plus
CG15211-PB 177 CG15211-PB 1..177 1..177 899 100 Plus
CG15211-PA 177 CG15211-PA 1..177 1..177 899 100 Plus

RE01453.pep Sequence

Translation from 283 to 816

> RE01453.pep
MVETVVNIERTTTTTTNGPPGGANPTVGSGGGFWSAIRLNIDYFRTIPGI
IKIVEFVLGIICMALAAPPLASATSFFMFVIVISFIINILLIAAYFLGIR
EALNVAVNWIFSELITTAVLTLLYFIGFIVQLARWSDATGKGSGSNTAAG
VFGLFNFLAYAAGTYFLFLAHRSGATH*

RE01453.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20425-PA 176 GF20425-PA 1..176 1..177 654 81.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18369-PA 173 GG18369-PA 1..173 1..177 716 92.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12613-PA 171 GH12613-PA 1..171 1..177 668 78.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15211-PE 177 CG15211-PE 1..177 1..177 899 100 Plus
CG15211-PD 177 CG15211-PD 1..177 1..177 899 100 Plus
CG15211-PC 177 CG15211-PC 1..177 1..177 899 100 Plus
CG15211-PB 177 CG15211-PB 1..177 1..177 899 100 Plus
CG15211-PA 177 CG15211-PA 1..177 1..177 899 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11027-PA 174 GI11027-PA 23..174 26..177 567 77 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14986-PA 163 GL14986-PA 1..55 1..58 143 74.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13573-PA 174 GA13573-PA 1..174 1..177 714 90.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11433-PA 177 GM11433-PA 1..177 1..177 875 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16987-PA 177 GD16987-PA 1..177 1..177 870 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15808-PA 81 GJ15808-PA 23..55 26..58 135 69.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16321-PA 174 GK16321-PA 24..174 24..177 615 87 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17857-PA 177 GE17857-PA 1..177 1..177 881 98.3 Plus