![]() | BDGP Sequence Production Resources |
Search the DGRC for RE01527
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 15 |
Well: | 27 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpS11-RA |
Protein status: | RE01527.pep: gold |
Sequenced Size: | 745 |
Gene | Date | Evidence |
---|---|---|
CG5184 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5184 | 2002-04-09 | Blastp of sequenced clone |
CG5184 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpS11 | 2008-04-29 | Release 5.5 accounting |
mRpS11 | 2008-08-15 | Release 5.9 accounting |
mRpS11 | 2008-12-18 | 5.12 accounting |
745 bp (745 high quality bases) assembled on 2002-04-09
GenBank Submission: AY095194
> RE01527.complete AGTGTTGCCAGACTGGCAGTGTGATGTAATTTGGTTTTTGTGAACCCTCT GCGAAGTAAATTAATAATGTCACTGAAAAGTGTATTTCTAAGTGCTCTTC GGAGTATTACTATGCCCGCTGTGCCGCTCCAGACTTCTAGGATACACACG AGCGCTTGCTGGCGGAAGGCGGAGGACCGCAAGGAAATGCTGGCATCTTT ACCGGCCAAAGACGAAGGAACCGTGGGCGAAAAGACCGTGGACATCGACA CACTTATCAACCGCAAGGCTAAGTTTTTCCCGGATGCCAGCACCGCCAAC ACGTTATTCAATGGAATACCCTTCAACGAGCTGCCCATCTGCAACATTCG CGTTTCACCCAACAACACAATTATTTCCGTCACGGATCACAAAGGAGTCC TCCGGCTGATACGATCCTGTGGAATTGAGGGATTCAAAAACACTCGCAAG GGAACCAACATAGCAGCTCAAGCTACAGCGGTTACCATTAGTGGAAAAGC CATTGAATTGGGCTGGAAGACAGTGCGAGTAAAGGTTCGTGGTCTTGGCC CTGGAAGAATGTCGGCCATCAAAGGACTGCAAATGGGTGGGCTGAACATC GTTTCCATTACCGACAACACACATGTTTCCTTCAATCCTCCAAGACCCCG AAAGCAGAGAAGTCTTTAATGTGCAACTTGTTAAGACAACTTGTTTAAAA GCAAAATACACAAATAGTCGTTTACAAGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS11-RA | 861 | mRpS11-RA | 2..733 | 1..732 | 3645 | 99.8 | Plus |
mRpS11.a | 746 | mRpS11.a | 3..396 | 1..394 | 1970 | 100 | Plus |
mRpS11.a | 746 | mRpS11.a | 410..744 | 393..727 | 1675 | 100 | Plus |
ns1-RA | 2043 | ns1-RA | 1..56 | 56..1 | 280 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 12897199..12897461 | 1..263 | 1300 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 12898094..12898260 | 561..727 | 835 | 100 | Plus |
chr3R | 27901430 | chr3R | 12897519..12897651 | 263..395 | 650 | 99.2 | Plus |
chr3R | 27901430 | chr3R | 12897703..12897805 | 393..495 | 515 | 100 | Plus |
chr3R | 27901430 | chr3R | 12897969..12898034 | 496..561 | 330 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 17072732..17072994 | 1..263 | 1315 | 100 | Plus |
3R | 32079331 | 3R | 17073627..17073798 | 561..732 | 845 | 99.4 | Plus |
3R | 32079331 | 3R | 17073052..17073184 | 263..395 | 665 | 100 | Plus |
3R | 32079331 | 3R | 17073236..17073338 | 393..495 | 515 | 100 | Plus |
3R | 32079331 | 3R | 17073502..17073567 | 496..561 | 330 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 16813563..16813825 | 1..263 | 1315 | 100 | Plus |
3R | 31820162 | 3R | 16814458..16814629 | 561..732 | 845 | 99.4 | Plus |
3R | 31820162 | 3R | 16813883..16814015 | 263..395 | 665 | 100 | Plus |
3R | 31820162 | 3R | 16814067..16814169 | 393..495 | 515 | 100 | Plus |
3R | 31820162 | 3R | 16814333..16814398 | 496..561 | 330 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Q-element | 759 | Q-element Q 759bp | 128..292 | 285..445 | 129 | 57.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 12897199..12897461 | 1..263 | 99 | -> | Plus |
chr3R | 12897520..12897650 | 264..394 | 99 | -> | Plus |
chr3R | 12897705..12897805 | 395..495 | 100 | -> | Plus |
chr3R | 12897969..12898034 | 496..561 | 100 | -> | Plus |
chr3R | 12898095..12898262 | 562..729 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 1..603 | 67..669 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 1..603 | 67..669 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 1..603 | 67..669 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 1..603 | 67..669 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 1..603 | 67..669 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 2..730 | 1..729 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 2..730 | 1..729 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 1..729 | 1..729 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 2..730 | 1..729 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS11-RA | 1..729 | 1..729 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17073053..17073183 | 264..394 | 100 | -> | Plus |
3R | 17073238..17073338 | 395..495 | 100 | -> | Plus |
3R | 17073502..17073567 | 496..561 | 100 | -> | Plus |
3R | 17073628..17073795 | 562..729 | 99 | Plus | |
3R | 17072732..17072994 | 1..263 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17073053..17073183 | 264..394 | 100 | -> | Plus |
3R | 17073238..17073338 | 395..495 | 100 | -> | Plus |
3R | 17073502..17073567 | 496..561 | 100 | -> | Plus |
3R | 17073628..17073795 | 562..729 | 99 | Plus | |
3R | 17072732..17072994 | 1..263 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17073053..17073183 | 264..394 | 100 | -> | Plus |
3R | 17073238..17073338 | 395..495 | 100 | -> | Plus |
3R | 17073502..17073567 | 496..561 | 100 | -> | Plus |
3R | 17073628..17073795 | 562..729 | 99 | Plus | |
3R | 17072732..17072994 | 1..263 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 12898960..12899060 | 395..495 | 100 | -> | Plus |
arm_3R | 12899224..12899289 | 496..561 | 100 | -> | Plus |
arm_3R | 12899350..12899517 | 562..729 | 99 | Plus | |
arm_3R | 12898454..12898716 | 1..263 | 100 | -> | Plus |
arm_3R | 12898775..12898905 | 264..394 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16813563..16813825 | 1..263 | 100 | -> | Plus |
3R | 16813884..16814014 | 264..394 | 100 | -> | Plus |
3R | 16814069..16814169 | 395..495 | 100 | -> | Plus |
3R | 16814333..16814398 | 496..561 | 100 | -> | Plus |
3R | 16814459..16814626 | 562..729 | 99 | Plus |
Translation from 66 to 668
> RE01527.hyp MSLKSVFLSALRSITMPAVPLQTSRIHTSACWRKAEDRKEMLASLPAKDE GTVGEKTVDIDTLINRKAKFFPDASTANTLFNGIPFNELPICNIRVSPNN TIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAVTISGKAIELGW KTVRVKVRGLGPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQRSL *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS11-PA | 200 | CG5184-PA | 1..200 | 1..200 | 1019 | 100 | Plus |
Translation from 66 to 668
> RE01527.pep MSLKSVFLSALRSITMPAVPLQTSRIHTSACWRKAEDRKEMLASLPAKDE GTVGEKTVDIDTLINRKAKFFPDASTANTLFNGIPFNELPICNIRVSPNN TIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAVTISGKAIELGW KTVRVKVRGLGPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQRSL *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17084-PA | 199 | GF17084-PA | 1..199 | 1..200 | 899 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21973-PA | 200 | GG21973-PA | 1..200 | 1..200 | 1029 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19559-PA | 203 | GH19559-PA | 1..203 | 1..200 | 842 | 80.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS11-PA | 200 | CG5184-PA | 1..200 | 1..200 | 1019 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23856-PA | 160 | GI23856-PA | 1..160 | 41..200 | 754 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21925-PA | 203 | GL21925-PA | 1..203 | 1..200 | 864 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18718-PA | 202 | GA18718-PA | 1..202 | 1..200 | 847 | 81.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15204-PA | 200 | GM15204-PA | 1..200 | 1..200 | 1035 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\mRpS11-PA | 200 | GD19136-PA | 1..200 | 1..200 | 1032 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10570-PA | 160 | GJ10570-PA | 1..160 | 41..200 | 767 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13384-PA | 204 | GK13384-PA | 28..204 | 24..200 | 820 | 89.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24607-PA | 200 | GE24607-PA | 1..200 | 1..200 | 1034 | 98.5 | Plus |