Clone RE01527 Report

Search the DGRC for RE01527

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:15
Well:27
Vector:pFlc-1
Associated Gene/TranscriptmRpS11-RA
Protein status:RE01527.pep: gold
Sequenced Size:745

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5184 2002-01-01 Sim4 clustering to Release 2
CG5184 2002-04-09 Blastp of sequenced clone
CG5184 2003-01-01 Sim4 clustering to Release 3
mRpS11 2008-04-29 Release 5.5 accounting
mRpS11 2008-08-15 Release 5.9 accounting
mRpS11 2008-12-18 5.12 accounting

Clone Sequence Records

RE01527.complete Sequence

745 bp (745 high quality bases) assembled on 2002-04-09

GenBank Submission: AY095194

> RE01527.complete
AGTGTTGCCAGACTGGCAGTGTGATGTAATTTGGTTTTTGTGAACCCTCT
GCGAAGTAAATTAATAATGTCACTGAAAAGTGTATTTCTAAGTGCTCTTC
GGAGTATTACTATGCCCGCTGTGCCGCTCCAGACTTCTAGGATACACACG
AGCGCTTGCTGGCGGAAGGCGGAGGACCGCAAGGAAATGCTGGCATCTTT
ACCGGCCAAAGACGAAGGAACCGTGGGCGAAAAGACCGTGGACATCGACA
CACTTATCAACCGCAAGGCTAAGTTTTTCCCGGATGCCAGCACCGCCAAC
ACGTTATTCAATGGAATACCCTTCAACGAGCTGCCCATCTGCAACATTCG
CGTTTCACCCAACAACACAATTATTTCCGTCACGGATCACAAAGGAGTCC
TCCGGCTGATACGATCCTGTGGAATTGAGGGATTCAAAAACACTCGCAAG
GGAACCAACATAGCAGCTCAAGCTACAGCGGTTACCATTAGTGGAAAAGC
CATTGAATTGGGCTGGAAGACAGTGCGAGTAAAGGTTCGTGGTCTTGGCC
CTGGAAGAATGTCGGCCATCAAAGGACTGCAAATGGGTGGGCTGAACATC
GTTTCCATTACCGACAACACACATGTTTCCTTCAATCCTCCAAGACCCCG
AAAGCAGAGAAGTCTTTAATGTGCAACTTGTTAAGACAACTTGTTTAAAA
GCAAAATACACAAATAGTCGTTTACAAGCAAAAAAAAAAAAAAAA

RE01527.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS11-RA 861 mRpS11-RA 2..733 1..732 3645 99.8 Plus
mRpS11.a 746 mRpS11.a 3..396 1..394 1970 100 Plus
mRpS11.a 746 mRpS11.a 410..744 393..727 1675 100 Plus
ns1-RA 2043 ns1-RA 1..56 56..1 280 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12897199..12897461 1..263 1300 99.6 Plus
chr3R 27901430 chr3R 12898094..12898260 561..727 835 100 Plus
chr3R 27901430 chr3R 12897519..12897651 263..395 650 99.2 Plus
chr3R 27901430 chr3R 12897703..12897805 393..495 515 100 Plus
chr3R 27901430 chr3R 12897969..12898034 496..561 330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17072732..17072994 1..263 1315 100 Plus
3R 32079331 3R 17073627..17073798 561..732 845 99.4 Plus
3R 32079331 3R 17073052..17073184 263..395 665 100 Plus
3R 32079331 3R 17073236..17073338 393..495 515 100 Plus
3R 32079331 3R 17073502..17073567 496..561 330 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16813563..16813825 1..263 1315 100 Plus
3R 31820162 3R 16814458..16814629 561..732 845 99.4 Plus
3R 31820162 3R 16813883..16814015 263..395 665 100 Plus
3R 31820162 3R 16814067..16814169 393..495 515 100 Plus
3R 31820162 3R 16814333..16814398 496..561 330 100 Plus
Blast to na_te.dros performed 2019-03-16 02:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Q-element 759 Q-element Q 759bp 128..292 285..445 129 57.2 Plus

RE01527.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:31:04 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12897199..12897461 1..263 99 -> Plus
chr3R 12897520..12897650 264..394 99 -> Plus
chr3R 12897705..12897805 395..495 100 -> Plus
chr3R 12897969..12898034 496..561 100 -> Plus
chr3R 12898095..12898262 562..729 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:46 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 1..603 67..669 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:14:03 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 1..603 67..669 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:34 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 1..603 67..669 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:05:06 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 1..603 67..669 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:25 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 1..603 67..669 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:37:01 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 2..730 1..729 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:14:03 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 2..730 1..729 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:34 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 1..729 1..729 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:05:06 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 2..730 1..729 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:25 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS11-RA 1..729 1..729 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:04 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17073053..17073183 264..394 100 -> Plus
3R 17073238..17073338 395..495 100 -> Plus
3R 17073502..17073567 496..561 100 -> Plus
3R 17073628..17073795 562..729 99   Plus
3R 17072732..17072994 1..263 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:04 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17073053..17073183 264..394 100 -> Plus
3R 17073238..17073338 395..495 100 -> Plus
3R 17073502..17073567 496..561 100 -> Plus
3R 17073628..17073795 562..729 99   Plus
3R 17072732..17072994 1..263 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:04 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17073053..17073183 264..394 100 -> Plus
3R 17073238..17073338 395..495 100 -> Plus
3R 17073502..17073567 496..561 100 -> Plus
3R 17073628..17073795 562..729 99   Plus
3R 17072732..17072994 1..263 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:34 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12898960..12899060 395..495 100 -> Plus
arm_3R 12899224..12899289 496..561 100 -> Plus
arm_3R 12899350..12899517 562..729 99   Plus
arm_3R 12898454..12898716 1..263 100 -> Plus
arm_3R 12898775..12898905 264..394 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:36:52 Download gff for RE01527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16813563..16813825 1..263 100 -> Plus
3R 16813884..16814014 264..394 100 -> Plus
3R 16814069..16814169 395..495 100 -> Plus
3R 16814333..16814398 496..561 100 -> Plus
3R 16814459..16814626 562..729 99   Plus

RE01527.hyp Sequence

Translation from 66 to 668

> RE01527.hyp
MSLKSVFLSALRSITMPAVPLQTSRIHTSACWRKAEDRKEMLASLPAKDE
GTVGEKTVDIDTLINRKAKFFPDASTANTLFNGIPFNELPICNIRVSPNN
TIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAVTISGKAIELGW
KTVRVKVRGLGPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQRSL
*

RE01527.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS11-PA 200 CG5184-PA 1..200 1..200 1019 100 Plus

RE01527.pep Sequence

Translation from 66 to 668

> RE01527.pep
MSLKSVFLSALRSITMPAVPLQTSRIHTSACWRKAEDRKEMLASLPAKDE
GTVGEKTVDIDTLINRKAKFFPDASTANTLFNGIPFNELPICNIRVSPNN
TIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAVTISGKAIELGW
KTVRVKVRGLGPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQRSL
*

RE01527.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17084-PA 199 GF17084-PA 1..199 1..200 899 86.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21973-PA 200 GG21973-PA 1..200 1..200 1029 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19559-PA 203 GH19559-PA 1..203 1..200 842 80.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS11-PA 200 CG5184-PA 1..200 1..200 1019 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23856-PA 160 GI23856-PA 1..160 41..200 754 89.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21925-PA 203 GL21925-PA 1..203 1..200 864 82.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18718-PA 202 GA18718-PA 1..202 1..200 847 81.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15204-PA 200 GM15204-PA 1..200 1..200 1035 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\mRpS11-PA 200 GD19136-PA 1..200 1..200 1032 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10570-PA 160 GJ10570-PA 1..160 41..200 767 90 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13384-PA 204 GK13384-PA 28..204 24..200 820 89.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24607-PA 200 GE24607-PA 1..200 1..200 1034 98.5 Plus