Clone RE01574 Report

Search the DGRC for RE01574

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:15
Well:74
Vector:pFlc-1
Associated Gene/Transcripttsu-RA
Protein status:RE01574.pep: gold
Sequenced Size:709

Clone Sequence Records

RE01574.complete Sequence

709 bp assembled on 2011-03-18

GenBank Submission: BT126144.1

> RE01574.complete
ATCTCCAGCAGAGTTTTTGCAACTGGCCAGACGCGGAACGAAAACGAAAT
AAAAATAAACCCATTCATTCTGCTTTTTAGACACAGAAAAAGAAAATGGC
CGATGTGTTGGACATTGACAATGCGGAGGAGTTCGAGGTGGACGAGGACG
GTGACCAGGGCATTGTGCGCCTGAAGGAAAAGGCGAAGCACCGCAAGGGA
CGCGGATTTGGAAGCGACAGTAACACCCGAGAGGCGATCCACAGCTACGA
GCGTGTGCGCAACGAGGACGACGATGAGCTGGAACCTGGTCCACAAAGGT
CCGTCGAGGGCTGGATACTGTTTGTCACCTCTATCCATGAGGAGGCGCAG
GAGGACGAGATTCAGGAAAAGTTCTGCGATTACGGAGAAATCAAGAACAT
TCACCTGAACCTCGACCGGCGTACTGGGTTCTCAAAGGGATACGCTCTCG
TCGAGTACGAGACCCACAAGCAGGCGCTCGCCGCCAAAGAGGCCCTGAAC
GGTGCCGAAATAATGGGACAGACCATTCAGGTTGACTGGTGCTTCGTTAA
GGGACCGAAGCGCGTTAAAAAGTCCGAAAAGCGTCGCAGATAAACGACTC
CCAGCCCCAAGAATAATTTTTTAAAATAGTTTAATGAATAGGCAACCGTA
CAAAGTCTATATGAATTGAAATAAATCAGATAACTCTAAAAAATAAAAAA
AAAAAAAAA

RE01574.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4998624..4999155 157..688 2660 100 Plus
chr2R 21145070 chr2R 4998379..4998534 1..156 780 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9111046..9111577 157..688 2660 100 Plus
2R 25286936 2R 9110801..9110956 1..156 780 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9112245..9112776 157..688 2660 100 Plus
2R 25260384 2R 9112000..9112155 1..156 780 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:31:27 has no hits.

RE01574.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:32:17 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4998379..4998534 1..156 100 -> Plus
chr2R 4998624..4999161 157..694 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-18 16:41:20 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
tsu-RA 1..498 96..593 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:56:54 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
tsu-RA 1..498 96..593 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:29:09 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
tsu-RA 1..498 96..593 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-18 16:41:19 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
tsu-RA 1..693 1..693 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:56:54 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
tsu-RA 3..691 1..689 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:29:09 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
tsu-RA 3..691 1..689 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:17 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9110801..9110956 1..156 100 -> Plus
2R 9111046..9111583 157..694 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:17 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9110801..9110956 1..156 100 -> Plus
2R 9111046..9111583 157..694 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:17 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9110801..9110956 1..156 100 -> Plus
2R 9111046..9111583 157..694 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:56:54 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4998306..4998461 1..156 100 -> Plus
arm_2R 4998551..4999088 157..694 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:02:30 Download gff for RE01574.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9112245..9112782 157..694 99   Plus
2R 9112000..9112155 1..156 100 -> Plus

RE01574.pep Sequence

Translation from 95 to 592

> RE01574.pep
MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHS
YERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIK
NIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCF
VKGPKRVKKSEKRRR*

RE01574.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11955-PA 165 GF11955-PA 1..165 1..165 846 97 Plus
Dana\GF16912-PA 415 GF16912-PA 18..90 75..147 144 39.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23412-PA 165 GG23412-PA 1..165 1..165 871 100 Plus
Dere\GG22991-PA 416 GG22991-PA 18..90 75..147 145 39.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19854-PA 165 GH19854-PA 1..165 1..165 852 98.2 Plus
Dgri\GH18352-PA 430 GH18352-PA 18..90 75..147 144 39.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
tsu-PA 165 CG8781-PA 1..165 1..165 866 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19803-PA 165 GI19803-PA 1..165 1..165 864 98.8 Plus
Dmoj\GI23336-PA 428 GI23336-PA 18..90 75..147 145 39.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17620-PA 165 GL17620-PA 1..165 1..165 851 97.6 Plus
Dper\GL24357-PA 418 GL24357-PA 18..90 75..147 145 39.7 Plus
Dper\GL26176-PA 158 GL26176-PA 35..109 72..147 136 39.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21317-PA 165 GA21317-PA 1..165 1..165 856 98.2 Plus
Dpse\GA20525-PA 418 GA20525-PA 18..90 75..147 145 39.7 Plus
Dpse\GA10331-PA 157 GA10331-PA 35..109 72..147 137 39.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21093-PA 165 GM21093-PA 1..165 1..165 866 99.4 Plus
Dsec\GM17877-PA 419 GM17877-PA 18..90 75..147 145 39.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10630-PA 165 GD10630-PA 1..165 1..165 866 99.4 Plus
Dsim\GD19237-PA 419 GD19237-PA 18..90 75..147 145 39.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18464-PA 165 GJ18464-PA 1..165 1..165 861 98.8 Plus
Dvir\GJ10336-PA 427 GJ10336-PA 18..90 75..147 145 39.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23248-PA 165 GK23248-PA 1..165 1..165 865 98.8 Plus
Dwil\GK14167-PA 401 GK14167-PA 19..91 75..147 145 39.7 Plus
Dwil\GK14925-PA 158 GK14925-PA 35..109 72..147 135 38.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19253-PA 165 GE19253-PA 1..165 1..165 871 100 Plus
Dyak\GE25546-PA 414 GE25546-PA 18..90 75..147 144 39.7 Plus

RE01574.hyp Sequence

Translation from 95 to 592

> RE01574.hyp
MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHS
YERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIK
NIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCF
VKGPKRVKKSEKRRR*

RE01574.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
tsu-PA 165 CG8781-PA 1..165 1..165 866 100 Plus