Clone RE02160 Report

Search the DGRC for RE02160

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:21
Well:60
Vector:pFlc-1
Associated Gene/Transcriptdnd-RA
Protein status:RE02160.pep: gold
Preliminary Size:618
Sequenced Size:848

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6560 2001-12-14 Blastp of sequenced clone
CG6560 2002-01-01 Sim4 clustering to Release 2
CG6560 2003-01-01 Sim4 clustering to Release 3
CG6560 2008-04-29 Release 5.5 accounting
CG6560 2008-08-15 Release 5.9 accounting
CG6560 2008-12-18 5.12 accounting

Clone Sequence Records

RE02160.complete Sequence

848 bp (848 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070906

> RE02160.complete
AGTGGTTGTGCAGCGACGAGCCAGTGATGTTGTGTTTGGTGGTTGAAGTT
GATCCAATTCTCAAGTTATCCGACTTTTCCTGAGTTGACCACCAGAAGAC
ACCGTCTTGGGCGGCCAGAGCAGATTGCCGAATCGGGGGGATACAGATAC
GGATATAGTGGTCGGAGATCGCACCGCCTCCTGGCTGTTATTCTCGCGTT
AATTATACGATGGGTCTGCTATCGCTGTTGCGTAAACTGAGACCCAATCC
GGAAAAGGAGGCTCGCATCCTGCTCCTAGGATTGGATAATGCTGGCAAGA
CCACGATACTGAAGCAGCTGGCATCGGAGGACATAACCACGGTAACGCCC
ACGGCAGGATTTAACATCAAGTCCGTGGCAGCCGATGGTTTCAAACTGAA
TGTATGGGATATTGGTGGTCAATGGAAGATACGTCCATATTGGAAGAACT
ATTTTGCGAATACTGATGTGCTGATCTATGTAATTGACTGTACAGATCGG
ACTCGCCTGCCCGAGGCGGGTAGTGAACTATTCGAAATGCTCATGGACAA
TCGGTTGAAGCAAGTTCCCGTGCTGATTTTCGCTAACAAACAGGATATGC
CGGATGCCATGAGTGCCGCCGAGGTGGCCGAGAAGATGAGCTTGGTGCAA
CTGCAGGGACGAACCTGGGAGATCAAGGCCTGTACCGCTGTGGATGGCAC
TGGACTAAAGGAGGGAATGGACTGGGTCTGCAAGAATATGAAGAAGTAAT
CTAAATTATAGTAATCGTCGCCTGTTAAGTTGTCCCTAAGAACTAAATAT
ACGTACCTACATTTCAACTCACCAAAAGTATCAAAAAAAAAAAAAAAA

RE02160.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
dnd-RA 911 dnd-RA 1..833 1..833 4150 99.8 Plus
CG6678-RA 2833 CG6678-RA 101..313 213..1 1050 99.5 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17709391..17709750 832..473 1785 99.7 Minus
chr3R 27901430 chr3R 17710853..17711065 213..1 1050 99.5 Minus
chr3R 27901430 chr3R 17710001..17710132 343..212 645 99.2 Minus
chr3R 27901430 chr3R 17709808..17709940 473..341 635 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:25:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:36:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21885675..21886035 833..473 1805 100 Minus
3R 32079331 3R 21887139..21887351 213..1 1050 99.5 Minus
3R 32079331 3R 21886093..21886225 473..341 665 100 Minus
3R 32079331 3R 21886286..21886417 343..212 660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21626506..21626866 833..473 1805 100 Minus
3R 31820162 3R 21627970..21628182 213..1 1050 99.5 Minus
3R 31820162 3R 21626924..21627056 473..341 665 100 Minus
3R 31820162 3R 21627117..21627248 343..212 660 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:36:22 has no hits.

RE02160.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:37:32 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17709391..17709749 474..832 99 <- Minus
chr3R 17709808..17709939 342..473 98 <- Minus
chr3R 17710003..17710131 213..341 99 <- Minus
chr3R 17710854..17711065 1..212 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:46:27 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
CG6560-RA 1..540 210..749 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:46:47 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
dnd-RA 1..540 210..749 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:26:46 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
dnd-RA 1..540 210..749 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:15:33 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
CG6560-RA 1..540 210..749 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:29:44 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
dnd-RA 1..540 210..749 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:30:23 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
CG6560-RA 1..832 1..832 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:46:46 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
dnd-RA 1..832 1..832 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:26:46 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
dnd-RA 5..836 1..832 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:15:34 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
CG6560-RA 1..832 1..832 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:29:44 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
dnd-RA 5..836 1..832 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:37:32 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21886288..21886416 213..341 100 <- Minus
3R 21885676..21886034 474..832 100 <- Minus
3R 21886093..21886224 342..473 100 <- Minus
3R 21887140..21887351 1..212 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:37:32 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21886288..21886416 213..341 100 <- Minus
3R 21885676..21886034 474..832 100 <- Minus
3R 21886093..21886224 342..473 100 <- Minus
3R 21887140..21887351 1..212 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:37:32 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21886288..21886416 213..341 100 <- Minus
3R 21885676..21886034 474..832 100 <- Minus
3R 21886093..21886224 342..473 100 <- Minus
3R 21887140..21887351 1..212 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:26:46 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17711398..17711756 474..832 100 <- Minus
arm_3R 17711815..17711946 342..473 100 <- Minus
arm_3R 17712010..17712138 213..341 100 <- Minus
arm_3R 17712862..17713073 1..212 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:52:22 Download gff for RE02160.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21627971..21628182 1..212 99   Minus
3R 21626507..21626865 474..832 100 <- Minus
3R 21626924..21627055 342..473 100 <- Minus
3R 21627119..21627247 213..341 100 <- Minus

RE02160.pep Sequence

Translation from 209 to 748

> RE02160.pep
MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAG
FNIKSVAADGFKLNVWDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRL
PEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMSLVQLQG
RTWEIKACTAVDGTGLKEGMDWVCKNMKK*

RE02160.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16955-PA 184 GF16955-PA 7..184 2..179 932 98.9 Plus
Dana\GF23441-PA 182 GF23441-PA 15..178 15..178 450 50.6 Plus
Dana\GF23416-PA 180 GF23416-PA 1..179 1..179 444 49.7 Plus
Dana\GF18345-PA 184 GF18345-PA 1..178 1..179 444 46.9 Plus
Dana\GF13030-PA 175 GF13030-PA 4..174 6..178 434 48 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12548-PA 179 GG12548-PA 1..179 1..179 935 98.3 Plus
Dere\GG13164-PA 182 GG13164-PA 15..178 15..178 450 50.6 Plus
Dere\GG20511-PA 175 GG20511-PA 4..174 6..178 439 48 Plus
Dere\GG16407-PA 180 GG16407-PA 1..179 1..179 439 49.2 Plus
Dere\GG10035-PA 157 GG10035-PA 1..140 1..141 404 53.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19902-PA 183 GH19902-PA 12..183 8..179 839 89.5 Plus
Dgri\GH14762-PA 182 GH14762-PA 15..178 15..178 450 50.6 Plus
Dgri\GH23951-PA 180 GH23951-PA 1..179 1..179 444 49.2 Plus
Dgri\GH14228-PA 184 GH14228-PA 1..178 1..179 434 46.4 Plus
Dgri\GH20425-PA 175 GH20425-PA 4..174 6..178 427 46.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
dnd-PA 179 CG6560-PA 1..179 1..179 932 100 Plus
Arf79F-PJ 182 CG8385-PJ 15..178 15..178 442 50.6 Plus
Arf79F-PI 182 CG8385-PI 15..178 15..178 442 50.6 Plus
Arf79F-PH 182 CG8385-PH 15..178 15..178 442 50.6 Plus
Arf79F-PF 182 CG8385-PF 15..178 15..178 442 50.6 Plus
Arf79F-PC 182 CG8385-PC 15..178 15..178 442 50.6 Plus
Arf79F-PE 182 CG8385-PE 15..178 15..178 442 50.6 Plus
Arf79F-PB 182 CG8385-PB 15..178 15..178 442 50.6 Plus
Arf79F-PA 182 CG8385-PA 15..178 15..178 442 50.6 Plus
Arl2-PA 184 CG7435-PA 1..178 1..179 440 46.9 Plus
Arf51F-PE 175 CG8156-PE 4..174 6..178 433 48 Plus
Arf51F-PA 175 CG8156-PA 4..174 6..178 433 48 Plus
Arf51F-PC 175 CG8156-PC 4..174 6..178 433 48 Plus
Arf51F-PB 175 CG8156-PB 4..174 6..178 433 48 Plus
Arf51F-PD 175 CG8156-PD 4..174 6..178 433 48 Plus
Arf102F-PB 180 CG11027-PB 15..179 15..179 426 49.1 Plus
Arf102F-PA 180 CG11027-PA 15..179 15..179 426 49.1 Plus
Arl1-PA 180 CG6025-PA 3..177 2..178 391 44.1 Plus
Arl5-PA 179 CG7197-PA 1..177 1..178 383 41 Plus
CG17819-PA 186 CG17819-PA 5..177 2..173 294 35.1 Plus
Arfrp1-PA 200 CG7039-PA 20..189 20..179 274 34.7 Plus
Arl6-PA 202 CG7735-PA 1..184 1..178 271 33.2 Plus
Arl6-PB 201 CG7735-PB 1..183 1..178 269 33.3 Plus
Arl4-PB 313 CG2219-PB 20..161 12..148 265 40.8 Plus
Arl4-PA 312 CG2219-PA 27..160 20..148 263 42.5 Plus
Sar1-PE 193 CG7073-PE 18..190 15..175 262 33.5 Plus
Sar1-PC 193 CG7073-PC 18..190 15..175 262 33.5 Plus
Sar1-PD 193 CG7073-PD 18..190 15..175 262 33.5 Plus
Sar1-PA 193 CG7073-PA 18..190 15..175 262 33.5 Plus
Arl8-PC 186 CG7891-PC 18..182 15..178 246 29.1 Plus
Arl8-PB 186 CG7891-PB 18..182 15..178 246 29.1 Plus
Arl8-PA 186 CG7891-PA 18..182 15..178 246 29.1 Plus
Arl4-PC 100 CG2219-PC 27..93 20..81 152 44.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22038-PA 437 GI22038-PA 260..437 2..179 875 90.4 Plus
Dmoj\GI11864-PA 182 GI11864-PA 15..178 15..178 450 50.6 Plus
Dmoj\GI14031-PA 180 GI14031-PA 1..179 1..179 443 49.2 Plus
Dmoj\GI24871-PA 184 GI24871-PA 1..178 1..179 433 45.3 Plus
Dmoj\GI19608-PA 175 GI19608-PA 4..174 6..178 432 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23729-PA 182 GL23729-PA 14..182 11..179 869 94.7 Plus
Dper\GL25178-PA 182 GL25178-PA 15..178 15..178 450 50.6 Plus
Dper\GL18404-PA 180 GL18404-PA 1..179 1..179 442 49.7 Plus
Dper\GL17751-PA 175 GL17751-PA 4..174 6..178 440 48 Plus
Dper\GL23431-PA 184 GL23431-PA 1..178 1..179 430 45.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19685-PA 182 GA19685-PA 14..182 11..179 869 94.7 Plus
Dpse\GA21036-PA 182 GA21036-PA 15..178 15..178 450 50.6 Plus
Dpse\GA10714-PA 180 GA10714-PA 1..179 1..179 442 49.7 Plus
Dpse\GA20856-PA 175 GA20856-PA 4..174 6..178 440 48 Plus
Dpse\GA20349-PA 184 GA20349-PA 1..178 1..179 430 45.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23682-PA 179 GM23682-PA 1..179 1..179 945 100 Plus
Dsec\GM22073-PA 182 GM22073-PA 15..178 15..178 450 50.6 Plus
Dsec\GM23726-PA 184 GM23726-PA 1..178 1..179 447 47.5 Plus
Dsec\GM21603-PA 175 GM21603-PA 4..174 6..178 439 48 Plus
Dsec\GM13026-PA 180 GM13026-PA 1..179 1..179 438 48.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18491-PA 179 GD18491-PA 1..179 1..179 945 100 Plus
Dsim\GD12049-PA 182 GD12049-PA 15..178 15..178 450 50.6 Plus
Dsim\GD18536-PA 184 GD18536-PA 1..178 1..179 448 47.5 Plus
Dsim\GD11108-PA 175 GD11108-PA 4..174 6..178 439 48 Plus
Dsim\GD20493-PA 180 GD20493-PA 1..179 1..179 438 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24091-PA 179 GJ24091-PA 1..179 1..179 880 91.6 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 15..178 15..178 450 50.6 Plus
Dvir\GJ19602-PA 180 GJ19602-PA 1..179 1..179 443 49.2 Plus
Dvir\GJ14973-PA 175 GJ14973-PA 4..174 6..178 432 47.4 Plus
Dvir\GJ24514-PA 184 GJ24514-PA 1..178 1..179 424 44.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13011-PA 193 GK13011-PA 22..193 8..179 845 90.1 Plus
Dwil\GK20496-PA 182 GK20496-PA 15..178 15..178 450 50.6 Plus
Dwil\GK13183-PA 184 GK13183-PA 1..178 1..179 445 47.5 Plus
Dwil\GK13623-PA 180 GK13623-PA 1..179 1..179 444 49.7 Plus
Dwil\GK20891-PA 175 GK20891-PA 4..174 6..178 437 48 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24074-PA 179 GE24074-PA 1..179 1..179 939 98.9 Plus
Dyak\GE19486-PA 182 GE19486-PA 15..178 15..178 450 50.6 Plus
Dyak\GE25871-PA 184 GE25871-PA 1..178 1..179 450 47.5 Plus
Dyak\GE13644-PA 175 GE13644-PA 4..174 6..178 439 48 Plus
Dyak\Arf102F-PA 180 GE14567-PA 1..179 1..179 435 49.2 Plus

RE02160.hyp Sequence

Translation from 209 to 748

> RE02160.hyp
MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAG
FNIKSVAADGFKLNVWDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRL
PEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMSLVQLQG
RTWEIKACTAVDGTGLKEGMDWVCKNMKK*

RE02160.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
dnd-PA 179 CG6560-PA 1..179 1..179 932 100 Plus
Arf79F-PJ 182 CG8385-PJ 15..178 15..178 442 50.6 Plus
Arf79F-PI 182 CG8385-PI 15..178 15..178 442 50.6 Plus
Arf79F-PH 182 CG8385-PH 15..178 15..178 442 50.6 Plus
Arf79F-PF 182 CG8385-PF 15..178 15..178 442 50.6 Plus