Clone RE02339 Report

Search the DGRC for RE02339

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:23
Well:39
Vector:pFlc-1
Associated Gene/TranscriptRpL10-RC
Protein status:RE02339.pep: gold
Sequenced Size:767

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17521 2001-12-14 Blastp of sequenced clone
CG17521 2002-01-01 Sim4 clustering to Release 2
CG17521 2003-01-01 Sim4 clustering to Release 3
Qm 2008-04-29 Release 5.5 accounting
Qm 2008-08-15 Release 5.9 accounting
Qm 2008-12-18 5.12 accounting

Clone Sequence Records

RE02339.complete Sequence

767 bp (767 high quality bases) assembled on 2006-06-05

GenBank Submission: AY070910

> RE02339.complete
GTCTTCCTTTTCTCGTGTGCTTCGTTGGAAGAGGAGTCGAAATGGGCCGA
CGACCAGCTAGATGCTACCGCTATTGCAAAAATAAGCCGTACCCTAAATC
TCGGTTTTGCCGTGGTGTCCCTGATCCAAAAATTCGTATATTTGATTTGG
GAAGAAAAAAAGCTACAGTTGAGGATTTTCCCCTGTGTGTTCATTTGGTT
TCTGATGAATACGAACAGCTGAGTAGTGAAGCTTTGGAAGCTGGACGCAT
TTGTTGCAACAAGTACTTGGTGAAGTACTGCGGTAAGGACCAGTTCCACA
TCAGAATGCGCCTGCATCCATTCCACGTCATTCGCATCAACAAAATGTTG
TCGTGCGCTGGAGCTGATAGGCTTCAAACTGGAATGCGAGGAGCGTTTGG
AAAACCGCAGGGCACGGTTGCTCGAGTTCGTATTGGTCAACCCATTATGT
CTGTCCGCTCTAGCGATCGTTACAAGGCTCAAGTTATTGAAGCTTTGCGG
CGTGCTAAGTTTAAGTTCCCTGGACGTCAAAAGATCTATGTTTCAAAGAA
GTGGGGATTCACCAAATACGAACGTGAGCGTTATGAAGAACTTCGCGATG
ACAACCGCCTTGAGCCTGATGGTTGCAATGTGAAATACCGCCCAGAGCAT
GGCCCGATTGCCGCATGGGAAAAAGCTCAGCGTGATGTTTATGCTTAATA
ACACATTGAAATAAAATGTCACTTAAAGTTTCGTAACTCAGAAACAATAT
ACAAAAAAAAAAAAAAA

RE02339.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Qm-RC 1127 Qm-RC 159..914 1..756 3780 100 Plus
Qm.e 1120 Qm.e 229..953 32..756 3625 100 Plus
Qm-RD 871 Qm-RD 71..794 33..756 3620 100 Plus
Qm.e 1120 Qm.e 67..100 1..34 170 100 Plus
Qm-RD 871 Qm-RD 28..61 1..34 170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 23083834..23084141 371..64 1540 100 Minus
chr3L 24539361 chr3L 23082589..23082809 752..532 1105 100 Minus
chr3L 24539361 chr3L 23083613..23083778 533..368 830 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:25:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 23094905..23095212 371..64 1540 100 Minus
3L 28110227 3L 23093656..23093880 756..532 1125 100 Minus
3L 28110227 3L 23094684..23094849 533..368 830 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 23088005..23088312 371..64 1540 100 Minus
3L 28103327 3L 23086756..23086980 756..532 1125 100 Minus
3L 28103327 3L 23087784..23087949 533..368 830 100 Minus
3L 28103327 3L 23088536..23088569 34..1 170 100 Minus
3L 28103327 3L 23088375..23088407 64..32 165 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:09:24 has no hits.

RE02339.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:10:21 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 23084366..23084398 1..33 100   Minus
chr3L 23083613..23083775 371..533 100 <- Minus
chr3L 23083835..23084140 65..370 100 <- Minus
chr3L 23082589..23082807 534..752 100 <- Minus
chr3L 23084204..23084234 34..64 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:46:36 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
Qm-RD 1..657 42..698 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:24:17 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
Qm-RD 1..657 42..698 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:22 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10-RC 1..657 42..698 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:43:17 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
Qm-RD 1..657 42..698 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:58 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10-RC 1..657 42..698 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:52:33 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
Qm-RC 1..752 1..752 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:24:17 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
Qm-RC 1..752 1..752 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:22 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10-RC 3..754 1..752 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:43:18 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
Qm-RC 1..752 1..752 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:58 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10-RC 3..754 1..752 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:21 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
3L 23093660..23093878 534..752 100 <- Minus
3L 23094684..23094846 371..533 100 <- Minus
3L 23094906..23095211 65..370 100 <- Minus
3L 23095275..23095305 34..64 100 <- Minus
3L 23095437..23095469 1..33 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:21 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
3L 23093660..23093878 534..752 100 <- Minus
3L 23094684..23094846 371..533 100 <- Minus
3L 23094906..23095211 65..370 100 <- Minus
3L 23095275..23095305 34..64 100 <- Minus
3L 23095437..23095469 1..33 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:21 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
3L 23093660..23093878 534..752 100 <- Minus
3L 23094684..23094846 371..533 100 <- Minus
3L 23094906..23095211 65..370 100 <- Minus
3L 23095275..23095305 34..64 100 <- Minus
3L 23095437..23095469 1..33 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:22 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 23086760..23086978 534..752 100 <- Minus
arm_3L 23087784..23087946 371..533 100 <- Minus
arm_3L 23088006..23088311 65..370 100 <- Minus
arm_3L 23088375..23088405 34..64 100 <- Minus
arm_3L 23088537..23088569 1..33 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:59 Download gff for RE02339.complete
Subject Subject Range Query Range Percent Splice Strand
3L 23086760..23086978 534..752 100 <- Minus
3L 23087784..23087946 371..533 100 <- Minus
3L 23088006..23088311 65..370 100 <- Minus
3L 23088375..23088405 34..64 100 <- Minus
3L 23088537..23088569 1..33 100   Minus

RE02339.hyp Sequence

Translation from 2 to 697

> RE02339.hyp
LPFLVCFVGRGVEMGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLG
RKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHI
RMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMS
VRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDD
NRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA*

RE02339.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
RpL10-PE 218 CG17521-PE 1..218 14..231 1183 100 Plus
RpL10-PD 218 CG17521-PD 1..218 14..231 1183 100 Plus
RpL10-PC 218 CG17521-PC 1..218 14..231 1183 100 Plus

RE02339.pep Sequence

Translation from 41 to 697

> RE02339.pep
MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCV
HLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRIN
KMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIE
ALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYR
PEHGPIAAWEKAQRDVYA*

RE02339.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20520-PA 218 GF20520-PA 1..218 1..218 1152 98.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16295-PA 218 GG16295-PA 1..218 1..218 1153 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19580-PA 218 GH19580-PA 1..218 1..218 1135 97.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
RpL10-PE 218 CG17521-PE 1..218 1..218 1183 100 Plus
RpL10-PD 218 CG17521-PD 1..218 1..218 1183 100 Plus
RpL10-PC 218 CG17521-PC 1..218 1..218 1183 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23790-PA 218 GI23790-PA 1..218 1..218 1139 97.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21963-PA 218 GL21963-PA 1..218 1..218 1138 97.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26129-PA 218 GA26129-PA 1..218 1..218 1138 97.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22490-PA 218 GM22490-PA 1..218 1..218 1154 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12046-PA 218 GD12046-PA 1..218 1..218 1154 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11194-PA 218 GJ11194-PA 1..218 1..218 1145 98.2 Plus
Dvir\GJ17194-PA 219 GJ17194-PA 1..218 1..218 1094 93.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10847-PA 218 GK10847-PA 1..218 1..218 1139 97.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19480-PA 218 GE19480-PA 1..218 1..218 1154 99.5 Plus